KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_23230Help
Entry
PFREUD_23230      CDS       T01252                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00250  Alanine, aspartate and glutamate metabolism
pfr00410  beta-Alanine metabolism
pfr00430  Taurine and hypotaurine metabolism
pfr00650  Butanoate metabolism
pfr01100  Metabolic pathways
pfr01110  Biosynthesis of secondary metabolites
pfr01120  Microbial metabolism in diverse environments
pfr02024  Quorum sensing
Module
pfr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFREUD_23230 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFREUD_23230 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFREUD_23230 (gadB)
   00430 Taurine and hypotaurine metabolism
    PFREUD_23230 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PFREUD_23230 (gadB)
Enzymes [BR:pfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PFREUD_23230 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CBL57837
UniProt: D7GH26
LinkDB All DBs
Position
2503808..2505220
Genome map
AA seq 470 aa AA seqDB search
MNDPTRHPAYSIDRSQLGAVEINPVFARPAEATEFSKFRLPASESLPETAYQVVHDEAML
DGNARLNLATFVGTWMDDYANRLYAESADKNMIDKDEYPKTAEIETRCWMMLADLWHAPD
PDNTIGTSTIGSSEACMLGGLALKRRWQHARKAAGKPTDHPNMVMSSAVQVCWEKFCNYW
DIEPRYVPISEDHKVLDGANLADYVDENTIGVVAIMGVTYTGMYEPVKQIAAALDEIQER
TGLDVKIHVDAASGGMIAPFIQPDLEWDFRIERVASINTSGHKYGLVYPGLGWVVWRSVD
DLPEDLIFKVSYLGGDMPTFALNFSRPGAQVLLQYYMFLRLGMDGFRRVQANSHDVAKFL
SSQIGAMDDFELWNDGSDIPVFAWRLKDRPNRKWDLYDLSERLRTRGWLVPAYPMPADLT
DVTVQRIVVRNGLSHDLADAFLESMRAEVAYLDALPAPMPSQHKQSGFHH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgatccgacccgtcatcccgcatactcaatcgatcgctcgcagcttggcgctgtg
gagatcaacccggtgttcgcccgccccgcggaggccaccgaattctcgaagttccgcctg
ccggcgtccgagagcctgcccgagaccgcctaccaggtggtgcacgacgaggccatgctc
gacggcaacgcccgcctcaacctggccaccttcgtgggcacttggatggacgactacgcc
aaccgcctctatgccgagtcggctgacaagaacatgatcgacaaggacgaataccccaag
accgccgagatcgaaacccgttgctggatgatgctcgccgacctgtggcacgcgcccgac
cccgacaacaccatcggcacgtcgaccatcggctcgtccgaggcctgcatgctgggtggc
ctggcgctcaagcgccgctggcagcacgcccgcaaggccgccggaaagcccaccgaccac
ccgaacatggtgatgtcgtcggccgtgcaggtgtgctgggagaagttctgcaactactgg
gacatcgagccccgctatgtgccgatctcggaggaccacaaggtgctcgacggcgccaac
ctggccgattacgtcgacgagaacaccatcggcgtggtggccatcatgggcgtcacctac
accggcatgtacgagccggtgaagcagatcgctgccgcgctcgacgagattcaggaacgc
accggcctcgacgtgaagatccacgttgacgcggcgtcgggcggcatgatcgccccgttc
atccagcccgacctcgaatgggacttccgcatcgagcgcgtggcatcgatcaacacctcg
ggccacaagtacgggctggtctaccccggcctgggctgggttgtctggcgcagcgtcgac
gacctgcccgaagacctcatcttcaaggtcagctacctgggcggcgacatgcccaccttc
gcgctgaacttctcgcgtcccggcgcgcaggtgctgctgcagtactacatgttcctgcgc
ctgggcatggacggcttccgccgcgtgcaagccaactcgcatgacgtggccaagttcctg
tcgagccagatcggcgccatggacgacttcgagctgtggaacgacggctccgacatcccg
gtgttcgcctggcggctgaaggatcgtccgaaccgcaagtgggacctctacgacctgtcg
gagcgcctgcgcacgcgtggctggttggtgcccgcctacccgatgccggccgacctcacc
gatgtcaccgtgcagcgcatcgtggtgcgcaatgggttgagccatgacctggccgacgcc
ttcctggagagcatgcgcgccgaggtggcctacctggacgccctgccggccccgatgccc
tcgcagcacaagcagtcgggcttccaccactga

DBGET integrated database retrieval system