KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_0213
Entry
RM25_0213         CDS       T03860                                 

Definition
(GenBank) Hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Pathway
pfre00620  Pyruvate metabolism
pfre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RM25_0213
Enzymes [BR:pfre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     RM25_0213
SSDB
Other DBs
NCBI-ProteinID: AJQ89945
UniProt: A0A0C5URS1
LinkDB
Position
complement(262053..265448)
AA seq 1131 aa
MSVVERRQINAAINLRLSLLGLPHPDSNAESPDAILVEPLLARQRELSRRLKDRLSAPDL
RIQRFLDDYLADCDEHPQLPRTTLVLDEPGLARGLSLPVDGDEFHSDIVASYRLVNGVLH
NPKHDRRTTAGVFHISTGGLPIPQDKVEVDKNVYARILARAFQAPDEELALPYTANLPEQ
AHCWASLLMRPTVLPAVPGRTTEKSYEVHFIVPGGLMCNLDFVEGIFGNAGDPYLPENDA
SLDPDSWTGHTGCVILAPHLTTMTKKSLGMPHYDDATERQRRDGQCWRHEDDLYNDGKAF
KVCARDERGVIVTVIADNYFGYCKKEVKTQISYSANLLGGAEEEHSGGAEVYPAWNLNQD
FTDRTPDDFTLADVISTNRELLDVRPEGYAVYKPEPNIVFIPEHSHYSMRTQTISWTAHG
AEQTIKLLAGKHYLSPDGYRIHAKHREMDATQWHLIGTSSRAVTCHKPATVSGGGKSEIS
KSISDAFVFGNAFSHDIDSAMDQVQALFDTDFTNRFADASRNGTDHRPVLSIDRSLGSVI
KLLTPSIQYNDEYNAFLEGIEPDVKELAFTVKRYYLPEWGEDWRSHFTVGIMNGRHGNMV
RLDGKKIITNMLRVGFREDGSWRLFTLRPDYSPAVKVQTEDDITASTVTPPWEDAEGLPR
KYVTNCEHLLFQRPDDAIHRGYDKQAEFDLASGTDTFISNFEPLTHEQARDLLTDVQAYS
EFTKPVRKLIERVAAMPDDQSPEFWVCSDDPRHLPDGGRSKNPRYLQVRPTDSNPELTTV
ADVAGKLARKLPLAGHAPQPIDVVAAGRRNNPPEDKVPALCAYNPLHYMELPELFMEYIS
SMTGKSPSTTGAGSEGALTKGPFNALPAVYDLNAALLSYALTDYDGWLSSAGYIGPNARV
DHDISMLIPELFSHMGPNDRNTKRLISEGYLEKMQDFDFDGHRVLASRLGYRINDRFVTH
YFGRIFLHPDVVFSEEMLRPELQDEKIFADSIDVIVKTHQRVAQMYFDDGTVSLACPPIR
ALLEIMAHGASAEGWTLDSPEFRKLFERESVLASDWYAQRLDAKQAEDVKQAEEGVERLK
EYIGRSDSGSVTGRLHLADRLRELEAQLTYERSPEYRQSLVGTLGRQPRFV
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgtccgtagtcgaacgccgccagatcaacgcagccatcaacctgaggctttcgttgctg
ggcctgccccatcccgacagcaatgctgagagccccgatgcgatccttgtggagccgctg
ctggcccgccagcgcgagttgagtcggcggttgaaggatcggctcagtgcccccgacctg
cgcatccagcgcttcctcgacgactacctggccgactgcgatgagcacccccagctgcca
cgcaccaccttggtgctcgacgagccgggcctggcccgcggcctgtcgctgccggtggac
ggcgacgaattccattccgacatcgtggcgtcatatcgccttgtcaacggcgtattgcac
aaccccaagcatgaccggcgcaccaccgccggggtgttccacatctccaccggcggcctg
cccatcccccaggacaaggtggaggtggacaagaacgtctacgcccgcatcctggcgcgc
gccttccaagcccccgacgaggagctggcgctgccctacaccgccaacctgcccgagcag
gcgcactgttgggcgtcgctgctcatgcgccccacggtgttgccggccgtgcccgggcgc
accaccgagaagagctacgaggtgcacttcatcgtgcccggtggcctgatgtgcaacctg
gacttcgtggagggcatcttcggcaatgccggcgacccctacctgcccgagaacgacgcc
tcgctcgacccggacagctggaccggccacaccggctgcgtgatcctggccccgcatctc
accacgatgaccaagaagagcctgggcatgccgcactacgacgacgccaccgagcgccag
cgtcgcgatggccagtgctggcgccacgaggacgacctctacaacgacggcaaggccttc
aaggtgtgtgcccgcgatgagcgcggcgtgatcgtcaccgtgatcgccgacaactacttc
ggctattgcaagaaggaggtgaagacccagatcagctattcggccaacctgttgggcggt
gccgaggaggagcactccggcggcgccgaggtgtatccggcatggaacctgaaccaggac
ttcactgaccgcacgcccgacgacttcacgctggccgatgtgatctccaccaatcgcgag
ctgctggacgtgcgccccgagggatatgccgtctacaagcccgaacccaatatcgtgttc
attccggagcattcgcattattcgatgcgcacccagacgatcagctggaccgcccatggc
gccgagcagaccatcaagttgctggccggcaagcactatctgtcgcctgacggctatcgc
atccatgccaagcaccgtgagatggatgccacccagtggcacctgatcggcacctcgtcg
cgggcggtcacctgccacaagccggccacggtgtcgggtggcggcaagagcgagatcagc
aagtcgatcagtgacgccttcgtgttcggcaatgccttctcgcacgatatcgacagcgcc
atggaccaggtgcaggcactcttcgacaccgatttcaccaatcgctttgccgacgcgtcc
cgcaacggcaccgatcatcgtccggtgctgtcgattgaccgctcgctgggttcggtgatc
aagctgctcaccccgtcaatccagtacaacgacgaatacaacgccttcctcgagggcatt
gagcccgatgtgaaggaattggcgttcaccgtcaagcgctattacctgcccgaatggggt
gaggactggcgcagccatttcaccgtgggcatcatgaatggccggcacgggaacatggtg
cgcctggacggcaagaagatcatcaccaatatgttgcgggtgggtttccgtgaggacggc
tcgtggcgcctgttcacgctgcgccccgattacagcccggccgtgaaggtgcagaccgag
gacgacatcaccgccagcacggtgaccccgccgtgggaggacgccgagggcctgccgcgc
aagtacgtgaccaactgcgagcacctgctgttccagcgtcctgacgatgcgatccaccgc
ggctacgacaagcaggccgagttcgacctggccagcggcaccgacaccttcatctcgaac
ttcgagccgctcacccatgagcaggcacgcgacctgctgaccgatgtgcaggcctacagc
gagttcaccaagccggtgcgcaagctcatcgagcgggttgccgcgatgcccgacgaccag
tcgcccgagttctgggtgtgctccgatgatccgcgccacctgcccgacggcggccggtcg
aagaacccgcgctacctgcaggtgcgtcccaccgactccaacccggagctgaccacggtg
gccgatgtggccggcaagctggcacgcaagctcccactggcaggccatgcgccgcagccg
atcgacgtggtcgccgcgggccggcgcaacaatccgccggaggacaaggttccggcgctg
tgcgcctacaacccgctgcactacatggagctgcccgagctgttcatggagtacatcagc
tcgatgaccggcaagtcgccgtccaccacgggtgccggctcggagggcgcgctcaccaag
ggcccattcaacgcactacctgccgtctacgacctgaatgcggctctgctgagctatgcg
ctcaccgactatgacggctggctcagctcggcgggctatatcggaccgaatgcccgggtt
gaccacgacatctcgatgctgattcccgaactgttctcgcacatggggcccaacgatcgc
aatacgaagcggttgatctccgagggctacctggagaagatgcaggacttcgacttcgac
gggcaccgcgtgctggcgagtcggctcggctaccgcatcaatgatcgcttcgtcacccac
tacttcggacgcatcttcctgcaccccgatgtggtgttcagcgaggaaatgttgcgccct
gagctccaggacgagaagatcttcgccgattcgatcgatgtgatcgtcaagacgcaccag
cgggtggcacaaatgtacttcgacgacggcaccgtgtcgctggcctgcccgccgatccgg
gcgctgctggagatcatggcgcacggcgcgtcggccgagggttggacgctggacagcccg
gagttccgcaagctgttcgagcgcgagtcggtgctggcgtcggattggtatgcgcagcgc
ctcgacgccaagcaggccgaggacgtgaagcaggccgaggagggcgtcgagcgcctcaag
gagtacatcgggcgctccgattcgggttcggtgaccggacgcctgcacctggccgatcgc
ctgcgtgagctggaggcgcagttgacctacgaacgctcgccggaataccgccagtcgctg
gtgggcacgctgggacgtcagcccaggttcgtctga

DBGET integrated database retrieval system