KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_0502Help
Entry
RM25_0502         CDS       T03860                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RM25_0502
Enzymes [BR:pfre01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RM25_0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 DAO Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_3 Thi4 K_oxygenase NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJQ90232
LinkDB All DBs
Position
610877..612532
Genome map
AA seq 551 aa AA seqDB search
MAVLDAALISQLNQLMDRVTHPVELVMSLDDRPESAQISDMLEQVAALSANITVRRDDAA
HDRRPAFSITRPGSDISITFAALPTGHEFNSFVLALLQVGGNPVKLDEKVVAGARAITTP
KNFVTYISLTCQNCPTVVQAINAMAVLNPLITNTVVDGSLFRDEVEAEKIKATPTMYLNG
ELFGQGRMEAAQILSGMDSDAGASMAAELSSRKPYQVLVVGQGPAGVASAIYLARKGIRT
ALIGDRFGGQVNDTLSIENVISVPHTEGPKLASDLRTHASQYEIDMIDGVRAAELLPATD
GDDLVGVRLEGDARLSADAVVLATGAHWRQMGVPGEQEYRNKGVTYCPHCDGPLFKGKDV
AVIGGGNSGIEAALDLAGVARHVTVVEFMPACKADEVLLDRVDQTTNITVLTNSAVTEVV
GDGSQVTGLHYDDRATGEHRELALDGVFVQIGLMPNTDWLKGAVKLDAHGQIVIDDRGAT
NVPRVFAAGDCTDVPFKQIIVAEGAGAIAGLSAWESLIREQSTAAPKGSDVASTTGSQDA
RKGEPQAAMAR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcttgacgcagccctcatctcccagctcaaccagctcatggaccgggtcacc
cacccggtcgagctggtgatgagcctcgacgaccgccccgaatcggcgcagatctccgac
atgctcgagcaggtcgccgcactgtcagcgaacatcaccgtgcgccgtgacgacgccgcc
cacgaccgccgcccggccttctcgatcacccgtccgggctccgacatctcgatcaccttc
gccgccctgcccaccggccacgagttcaactcgttcgtgctggcgctgctgcaggtgggt
ggcaacccggtgaagctcgacgagaaggtggtggcgggtgccagggcgatcaccaccccg
aagaacttcgtcacctacatttcgctgacctgccagaactgccccaccgtggtgcaggcc
atcaatgcgatggccgtgctcaacccgctgatcaccaacacggtcgtcgatggctcgctg
ttccgtgatgaggtggaggcagagaagatcaaggccacgcccacgatgtacctcaacggc
gagctcttcggccagggacgcatggaggccgcgcagatcctgtcgggcatggattccgac
gccggcgcctccatggccgctgagctgtcgtcccgcaagccctaccaggtgctcgtggtg
ggccagggcccggccggtgtcgcctcggcgatctacctggcccgcaagggcatccgcacc
gccctgatcggcgatcgcttcggtggccaggtcaatgacacgttgtccatcgagaacgtg
atctcggtgccgcacaccgagggcccgaagctggcctccgacctgcgcacccacgcctcg
cagtacgagatcgacatgatcgacggggtgcgggccgccgagctgctccccgccacggac
ggcgacgatctggtgggggtgcgtctggagggcgacgcgcggttgtccgccgatgcggtg
gtgctcgccacgggcgcgcactggcgccagatgggggtccccggcgagcaggagtaccgc
aacaagggcgtcacctactgcccgcactgcgacggtccgctgttcaagggcaaggacgtc
gccgtcatcggcggcgggaactcgggcattgaggccgccctcgacctggccggcgttgcc
cgccacgtcaccgtggtcgagttcatgcccgcttgcaaggccgacgaggtgctccttgac
cgcgtcgaccagaccaccaacatcaccgtgctcaccaattcggcggtcaccgaggtggtg
ggcgacggatcacaggtcaccggcctgcactacgacgacagggccaccggcgagcaccgt
gagctcgccctggacggcgtcttcgtgcagatcgggctcatgcccaacaccgattggttg
aagggcgccgtgaagctcgacgcgcatggccagatcgtcatcgacgatcggggtgccacc
aatgtgccgcgcgtcttcgcggccggtgactgcaccgacgttcccttcaagcagatcatc
gtggctgagggtgccggtgcgatcgccgggctgtcggcctgggaatccttgatccgcgag
cagtccacggcggctccgaagggctccgatgtggcgtccacgacgggctcgcaggacgcc
cggaagggcgagccacaggcggcgatggcacgctga

DBGET integrated database retrieval system