KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_0658Help
Entry
RM25_0658         CDS       T03860                                 

Definition
(GenBank) Enoyl-CoA hydratase echA9
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Pathway
pfre00071  Fatty acid degradation
pfre00280  Valine, leucine and isoleucine degradation
pfre00310  Lysine degradation
pfre00360  Phenylalanine metabolism
pfre00362  Benzoate degradation
pfre00380  Tryptophan metabolism
pfre00410  beta-Alanine metabolism
pfre00627  Aminobenzoate degradation
pfre00640  Propanoate metabolism
pfre00650  Butanoate metabolism
pfre00903  Limonene and pinene degradation
pfre01100  Metabolic pathways
pfre01110  Biosynthesis of secondary metabolites
pfre01120  Microbial metabolism in diverse environments
pfre01130  Biosynthesis of antibiotics
pfre01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RM25_0658
   00650 Butanoate metabolism
    RM25_0658
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RM25_0658
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RM25_0658
   00310 Lysine degradation
    RM25_0658
   00360 Phenylalanine metabolism
    RM25_0658
   00380 Tryptophan metabolism
    RM25_0658
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RM25_0658
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RM25_0658
   00281 Geraniol degradation
    RM25_0658
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RM25_0658
   00627 Aminobenzoate degradation
    RM25_0658
   00930 Caprolactam degradation
    RM25_0658
Enzymes [BR:pfre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RM25_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AJQ90385
LinkDB All DBs
Position
complement(767438..768370)
Genome map
AA seq 310 aa AA seqDB search
MADGDVQFEVREGTGYLRLMRPTALNALSPQMIAVITEQLSAWRDDASVQALDISGEGRA
YCAGADVRWMRSTMIENGVQSALEFLADEYAMDAVVAQFGKPVTTHLHGVAMGGGLGLGM
HGATRVATADLAMAMPEVGIGLWPDVGMLFEFSRLPGEIGTWLALTGLTIDANTALAAGL
VDQVDLMSAKPDLDLAWVDDYFVGDDAREIITRLEASSDERAVQAGELIRTRSPLSVAVS
LAAIRRAATLHSVGDVLDQDLAIARALLPDPQCDFVEGVRAQLVDKDRQPHWSVARIEDI
DPDKARAIVG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccgatggtgatgtgcagttcgaggtgcgtgagggcaccggctacctgcggctgatg
cgccccacggcgctcaatgccctgtcgccccagatgatcgccgtgatcaccgaacagctg
agcgcctggcgcgacgatgcgtccgtgcaggccctggacatcagcggcgagggccgtgcc
tattgcgcgggcgccgatgtgcgctggatgcgctccacgatgatcgagaacggcgtgcag
tccgcactggagttcctggccgacgagtacgcgatggacgccgtcgtggcccagttcggc
aagcccgtcaccacccacctgcacggcgtggcgatggggggcggactgggattgggcatg
cacggggccacccgcgtggccaccgccgacctggcgatggcgatgcccgaggtgggcatt
gggctgtggcccgacgtcggaatgctgttcgagttctcgcgactgccgggcgagatcggc
acgtggctggccctgaccgggctcacgatcgatgcgaacacggcgctggcagcgggcctg
gtcgaccaggttgacctgatgtccgccaagcctgacctggacctggcatgggtggacgac
tacttcgtgggcgacgacgcccgcgagatcatcacccgcctggaggccagtagcgatgag
cgtgccgtgcaggccggcgagctgatccgcacgcgttcccccctgtcggtcgccgtgtcg
ctggccgcgatccgtcgcgcagccacgctccacagcgtcggtgatgtgctcgaccaggac
ctcgccattgcccgggcgctgctccccgatccgcaatgcgacttcgtggagggcgtgcgg
gcccagctggtggacaaggaccgccagccccactggtcggtggcccgtatcgaggacatt
gatcccgacaaggcccgcgccatcgtcggctga

DBGET integrated database retrieval system