KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_0671Help
Entry
RM25_0671         CDS       T03860                                 

Definition
(GenBank) Chlorophyll synthesis pathway protein BchC
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 Glu_dehyd_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJQ90398
LinkDB All DBs
Position
complement(780442..781485)
Genome map
AA seq 347 aa AA seqDB search
MAETMLAERFYAKDHSIHLEEIPIPEPGPGEVLMKVAYCGICHSDLSLINGNFPPSLPVV
TQGHEASGTIVKLGPGVTGWSVGDRVIPSAGRPCMVCRKCRRGDFASCLHLHLMAFAYDG
AWAQYHVASAMGLTKIPDNVAMDQAALLADAVSTPYAAVVRTAQVHTGNAVAIWGVGGVG
THLVQLARGAGAVPLIAIDLNDEVLERAKRLGADFAFHSDDPDLMKKIEEVTNGRMIDVA
FDAVGIQATVRAAVESLDVNGKVVTLGLSDQDIDAGPFLDFNLQRKQVRGHLGYQGQDIA
ILAEMLSFGRLDLSESISDVVPLSEVERGIDDLKNHKGNPIRILVKP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacgatgcttgccgagcgtttctacgcgaaggaccacagtattcacctcgag
gagatcccgatccccgaaccgggacccggcgaggttctcatgaaggtcgcctactgtggc
atctgtcattccgacctgagcctgatcaatggcaacttcccgccgtcactgccggtggtc
acccagggccacgaggccagcggcaccattgtcaagctcggaccgggcgtcaccggttgg
agcgtcggcgaccgtgtcatcccctcggccggacgtccctgcatggtgtgccgcaagtgc
cgccgcggcgacttcgccagctgcctgcacctgcacctgatggccttcgcctacgacggc
gcctgggcccagtaccacgtggcctcggccatgggcctcaccaagatccccgacaacgtt
gccatggatcaggccgccctgctcgctgacgcagtatccaccccctacgccgccgtggtg
cgcaccgcccaggtgcacaccggaaatgccgtggccatatggggcgtcggcggcgtcggc
acgcacctcgtgcaattggcgcgtggcgccggcgccgtgccgctgatcgccattgacctg
aacgacgaggtgctggagcgggccaagcgcctgggcgccgacttcgccttccactccgat
gatcccgacctgatgaagaagatcgaggaagtcaccaacggccgcatgatcgacgtcgcc
ttcgacgccgtcggcatccaggccacggtgcgggcagccgtcgaatcgctcgacgtcaac
ggcaaggtcgtcacgctgggcctgtccgaccaggacattgacgccggcccgttcctggac
ttcaacctgcagcgcaagcaggtgcgtggccacctcggctaccagggccaggacatcgcg
atccttgccgagatgctctcgttcggacgcctggacctgtccgaatccatcagcgacgtg
gtaccgctgtccgaggttgagcgcggcatcgacgacctgaagaaccacaagggcaacccg
atccgcatcctcgtgaagccctga

DBGET integrated database retrieval system