KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_1382Help
Entry
RM25_1382         CDS       T03860                                 

Definition
(GenBank) Glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfre02000]
    RM25_1382
Transporters [BR:pfre02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    RM25_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP FixS
Motif
Other DBs
NCBI-ProteinID: AJQ91092
LinkDB All DBs
Position
complement(1575040..1575831)
Genome map
AA seq 263 aa AA seqDB search
MLLLQTVTSAQIFGSEFLGTMLLTMLGVGVVANALLAKTKGHAGGPQFINWGWGIAVMIG
VYGAYRTGGHLNPAVTLGLWAGGKPLAAGIPATGTNIMLYIVAQMLGGFCGAVLAWLVYK
RHYDEPGEPGDKLGTFCTAPAIRAYGWNFLVEFIGTWVLVIWVILSGYTNIASITIDSTG
ISNVTGTLIGPLGVMLVIVGIGNSLGGPTGYAINPARDLSPRIAHAILPIKGKGGSDWSY
SWVPVIAPLAGGIAAGLTYQLFW
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgttacaaactgtgacatcggcccagatcttcggttcggagttcttgggcacg
atgcttcttacgatgctcggtgttggtgtggttgccaacgcgttactcgccaagacgaag
ggacatgccggaggaccacagttcatcaactggggctggggtattgcggtcatgatcggc
gtctacggcgcctaccgcaccggcggccacctgaaccctgccgtcacgctcggcctgtgg
gccggcggtaagccactggcagccggcatccccgccaccggcaccaacatcatgttgtat
atcgtcgcccagatgttgggcggcttctgcggtgccgtcctggcctggttggtctacaag
cgccactacgacgagcccggggagcccggcgacaagctgggtaccttctgcaccgcacct
gcgatccgtgcctacggctggaacttcctggtcgagttcatcggcacgtgggtgctggtc
atctgggtcatcctgtcgggctacaccaacatcgcaagcatcaccatcgattcgaccggc
atcagcaatgtcaccggtaccctgatcggccccctcggcgtcatgttggtcatcgtcggc
atcggtaactcactgggcggacccaccggatacgccatcaacccggcacgagacctgtcg
ccgcgtatcgcccacgccatcctgcccatcaagggcaagggcggctccgactggtcctac
tcgtgggtcccggtcatcgcacccctggcgggtggcatcgccgccggcctcacctaccag
ctgttctggtga

DBGET integrated database retrieval system