KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_1871Help
Entry
RM25_1871         CDS       T03860                                 

Definition
(GenBank) Non-specific serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfre01001]
    RM25_1871
Enzymes [BR:pfre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RM25_1871
Protein kinases [BR:pfre01001]
 Serine/threonine kinases: Other
  Bacterial family
   RM25_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal Pilin_N Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: AJQ91575
LinkDB All DBs
Position
2108127..2109911
Genome map
AA seq 594 aa AA seqDB search
MTDSPIVLGDRYELRSVIGRGGMAEVWQARDLRLGREVAVKRLRADLATDPTFQTRFQRE
AQSAAGLNHPNIVSVYDTGSQEDSATGVMRPYIVMELVSGHTLREILHEGRTIVPAKALE
YTAGVLDALSFSHKHGIIHRDIKPANVMITPSGQVKVMDFGIARAVADTSATMTQTAAVI
GTAQYLSPEQARGETVDSRSDIYSAGCLLYELLTGRPPFIGDSPVAVAYQHVREQPVPPS
RLDPEVTPDIDAIVLKSLEKDPNDRYQTAAEMRDDILRVLNGEAATGATAVVPAPFAMPS
ATDATTVLPSASQPLSAPTTPPRRAVEAPRAPKKKKKRRVSAPTALLIGLLVILLTVMGV
VLFRMNSDSNKATPDTTVPAVIGFSEDQATSTIRNAKLDPKVEHQSGPADTKGRVVATDP
GASTTVAVGSTVTVKINDGPAATRLPDVRGKTEDVARQMLTSAGFTAIATKDASESQEGT
ESAAGTIVATDPSAGATVDPASPITLYRATGRSSVPDVSSLGVSADAAIKLLSQAGFHNV
KSTPVAQCQSGIVCEQTPTAGTSYLRTDQVNILVGQIVSPSPSPSLTPSPSRSS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactcacccatcgtgctcggcgatcgctatgagttgcgcagcgtcatcggacgc
ggcggcatggccgaggtgtggcaggcccgtgacctgcgcctgggccgcgaggtggccgtc
aagcgcctgcgcgccgacctggccaccgatcccaccttccagacccgcttccagcgtgag
gcccaatcggccgccggcctgaaccatcccaatatcgtgtcggtctacgacaccggcagc
caggaggactccgccaccggcgtgatgcgcccctacatcgtcatggagctcgtgagcggc
cacacgctgcgcgagatcctgcacgagggacgcaccatcgtgcccgcgaaggcactcgaa
tacaccgccggcgtgctcgacgcgctgagtttctcgcacaagcacggcatcatccatcgc
gacatcaagcccgccaatgtgatgatcaccccgtcgggccaggtcaaggtgatggacttc
ggcatcgcccgggccgtcgccgacacctccgcgacgatgacccagaccgccgccgtgatc
ggcacggcgcaatacctgtcgcccgagcaggcccgcggcgagaccgtcgattcgcgctcc
gacatctattcggccggctgcctgctctacgagctgctcaccgggcgtcccccgttcatc
ggcgattcaccggtggccgtggcgtaccagcatgtgcgcgagcagccggtgccgcccagc
cggctcgatccggaggtcacccccgacatcgacgcgatcgtgttgaagtcgctggagaag
gaccccaacgaccgctaccagaccgccgccgagatgcgtgacgacatcctgcgcgtgctc
aacggcgaggcggccactggcgccaccgccgtggtgccggcacccttcgcgatgccgtcg
gccaccgacgccaccaccgtgctgccctcggcctcccagccgctcagcgcaccgaccacg
ccaccgcgtcgggccgtcgaggccccgcgtgcgcccaagaaaaagaagaagcgccgggtc
agtgcgcccaccgcgctgttgatcggcctcctggtgatcctgctcaccgtgatgggcgtg
gtgctgttccggatgaactccgattcgaacaaggccacccccgatacgacggtgccggcg
gtgatcgggttctccgaggaccaggccacctcgaccatccgcaatgccaagctcgacccg
aaggtggagcaccagtccggcccggccgacaccaagggacgcgtggtcgccaccgacccg
ggtgccagcaccacggtggccgtggggtccacggtgacggtgaagatcaatgacggcccg
gcggccaccaggctgcccgatgtgcgcggcaagacggaggacgtggcccgccagatgctc
acctcggccgggttcaccgccatcgccacgaaggacgccagcgagtcccaggagggcacc
gagagcgccgccggcaccatcgtggccaccgaccccagcgccggcgccaccgtcgatccc
gccagcccgatcaccctgtaccgcgccaccggacgctcgtcggtgcccgatgtgagcagc
ctaggggtgagcgccgatgccgcgatcaagttgttgtcgcaggccggattccacaatgtg
aagtccacccccgtcgcgcagtgccagagcggcatcgtgtgcgagcagacaccgactgcc
ggcacgtcgtatctgcgcaccgaccaggtgaacatcctggtgggccagatcgtctcgccc
agcccctcgccgtcactgaccccctcgccgtcacgttcgagttag

DBGET integrated database retrieval system