KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_2127Help
Entry
RM25_2127         CDS       T03860                                 

Definition
(GenBank) DAK1 domain protein
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Brite
KEGG Orthology (KO) [BR:pfre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RM25_2127
Enzymes [BR:pfre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     RM25_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-ProteinID: AJQ91831
LinkDB All DBs
Position
complement(2401076..2402794)
Genome map
AA seq 572 aa AA seqDB search
MTYLVNDPKQFAADSLTGMVAANEDYLTEVHGGVTRATDSPQGEVAVIVGGGSGHYPAFA
GWVGPGMAHGAVCGNIFASPSASQVESVVRASDHGGGAVLLFGNYAGDRLQFGAAQSPLG
ADGIDTRIVTISDDIASDTPQNWKDRRGIAGDLFVVKAACAAAAAGRDLDAVEAAANKAN
EATRSMGVAFTGCTLPGADEPLFTVPEGEYALGLGIHGEPGISSHKMDTAEGIATLLVER
VLAEEPTRTAGGYDGHVAVLVNGLGATKYEELFVLYGTVKKLLTEHGLTIVHPIVGEQVT
SLDMAGVSLSLMYLDPDLEELWLAPGDSPAYKTGSVTAGQRREVVAHDEKVAIRAGSPES
AAQAEELLPLLQALADMSSANEASLGKLDSIAGDGDHGQGMVLGSTAALKAAKQAVAAHA
GTSTLFDVAGAAWSEGAGGTSGALWGAALRELGTMLSDDQAATDDRLGRAAIAAARRFAQ
LGEARPGDKTMVDATAPFADELTARLDAGDDLATAWAAAAKAATKGAESTADMVARKGRA
RTHGTASLGHQDPGAVSFALLMSGLADRLANS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatctggtcaatgatcccaagcagttcgccgccgacagcctgaccggcatggtg
gcggccaacgaggactacctcacagaggtacatggcggggtgacccgcgccaccgacagc
ccgcagggcgaggtcgccgtgatcgtgggcggcgggtcgggccattacccggccttcgcc
ggctgggtcggccccggcatggcccatggcgccgtctgcggcaatatcttcgcctcaccc
tccgcctcgcaggtggagtcggtggtgcgcgcctccgaccacggcggcggcgcggtgctg
ctgttcggcaactatgccggtgaccgcctgcagttcggcgcggcacaatcccccctgggt
gccgacggcatcgacacccgcatcgtcaccatctccgacgacatcgcctccgacaccccc
cagaactggaaggaccgccgcggcatcgccggcgacctgttcgtggtgaaggccgcctgc
gccgcagccgccgccggacgcgacctggacgccgtcgaggccgccgccaacaaggccaac
gaggccacccggtcaatgggcgtcgccttcaccggctgcaccctgcccggcgctgacgag
cccctgttcaccgtgccggagggcgaatacgccctgggcctgggcatccacggcgagccc
ggcatctccagccacaagatggacaccgccgagggcatcgcgacgctgttggtcgaacgc
gtcctcgccgaggaacccacccgcaccgccggcggctacgacggccacgttgccgtgctg
gtcaacggcctgggcgccaccaagtacgaagagctgttcgtgctctacggcaccgtgaag
aagctgctcaccgagcacggactcacgatcgtgcaccccatcgtcggcgagcaggtgaca
tcgctcgacatggccggggtctccctgtccctgatgtacctcgaccccgacctcgaggaa
ctgtggctcgcccccggcgactcgcccgcctacaagaccggcagcgtcaccgccggtcag
cgccgcgaggtcgtcgcccatgacgagaaggtggccatccgggccggcagccccgaatcc
gccgcgcaggccgaggagctgctgccgctgctgcaggccctcgcggacatgtcgagcgcc
aacgaggcgtcgctgggcaagctcgactccatcgccggcgacggcgaccacggccagggc
atggtgctgggcagcaccgcggcactgaaggccgcaaagcaggcagttgccgcccatgcc
ggcacgtccaccctgttcgacgtggccggcgccgcctggtccgagggcgccggcggcacc
tcgggggccctgtggggcgccgcactgcgcgaactcggcacgatgctctccgacgaccag
gccgccacggacgaccgtctcggccgcgccgccatcgccgccgcccgccgcttcgcccaa
ctcggcgaggcgcgtcccggcgacaagacgatggtggacgccacagctccgttcgccgac
gagctcaccgcgcggctggacgccggcgatgacctcgccacggcctgggccgccgccgcg
aaggccgccaccaagggcgcggaatccaccgccgacatggtggcccgcaaggggcgcgcc
cgcacgcacggcacggcctcgctgggccatcaggaccccggcgcggtctcgttcgcgctg
ctcatgtcgggattggccgaccggctcgcgaacagctga

DBGET integrated database retrieval system