KEGG   Pseudomonas fluorescens SBW25: PFLU_0706Help
Entry
PFLU_0706         CDS       T00899                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00473  D-Alanine metabolism
pfs00550  Peptidoglycan biosynthesis
pfs01100  Metabolic pathways
pfs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PFLU_0706 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PFLU_0706 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PFLU_0706 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfs01011]
    PFLU_0706 (ddlA)
Enzymes [BR:pfs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PFLU_0706 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:pfs01011]
 Precursor biosynthesis
  Amino acid ligase
   PFLU_0706 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: CAY46974
UniProt: C3KBW8
LinkDB All DBs
Position
809019..810113
Genome map
AA seq 364 aa AA seqDB search
MSKVRVGIIFGGRSAEHEVSLQSARNIVDALDRTRFEPVLIGIDKAGHWHLNDTSNFLLN
QENPALIALNQSNRELAVVPGKASQQLVETSGTGLLEHVDVIFPIVHGTLGEDGCLQGLL
RMADLPFVGSDVLGSAVCMDKDISKRLLRDAGIAVTPFITLTRSNATRTSFDTAVNTLGL
PMFVKPANQGSSVGVSKVGTEAEYHAAVELALGFDEKVLVESAVKGREIECAVLGNEHPI
ASGCGEIVVSSGFYSYDSKYIDDQAAQVVVPAAISHDASERIRGLAIEAFEVLGCSGLAR
VDVFLTDDGNVLINEINSLPGFTRISMYPKLWQAAGMSYSELVSRLIELALERHAGRKGL
KISR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtgcgggtaggtattatttttggtggccgttcggcggagcatgaagtctcg
ttgcaatcggcgcgcaatattgtcgatgcactcgaccgtacgcgcttcgagccggtcctg
atcggtatcgacaaggccggccactggcacctcaacgacacctcgaacttcctgctcaac
caggaaaatccggccctgatcgcgctcaaccagtccaatcgcgaactggctgtagtgccc
ggcaaggccagccagcaactggtggaaacctcaggcacgggcctgttggaacatgtcgat
gtgatcttccccatcgtccacggcaccctcggcgaagacggctgcctgcaagggctgttg
cgcatggctgacctgcctttcgtcggctccgacgtacttggctcggcggtgtgcatggac
aaggacatcagcaagcgcttgctgcgcgatgccggcatcgccgttaccccgtttatcacg
ctgacccgcagcaatgccacgcgcacgtccttcgatacggcggtgaacacgctcggcctg
ccgatgttcgttaaaccggccaaccaaggttcgtctgtaggcgtgagtaaagtcggcacc
gaagccgagtaccacgctgccgttgaactggccctgggctttgatgaaaaggtgttggtt
gagtccgccgtaaagggccgtgaaatcgaatgcgccgtgttgggcaatgagcaccccatc
gccagcgggtgtggtgagatcgtggtgagcagcggtttctattcctacgacagcaaatat
atcgacgaccaggccgcccaagtggtggtgccggccgctatcagccatgacgccagcgag
cgcattcgtggactggccattgaggcgttcgaggtgctgggctgttccggtttggcgcgg
gtcgacgtgtttctcaccgacgacggcaacgtgctgatcaacgaaatcaactcactgccc
ggcttcacccgtatcagcatgtaccccaaactgtggcaggcagcgggcatgagctacagc
gaactggtgagccgcttgatcgagctggcgctggaacggcatgcggggcgcaaggggttg
aagatcagtcgctga

DBGET integrated database retrieval system