KEGG   Pseudomonas fluorescens SBW25: PFLU_1023Help
Entry
PFLU_1023         CDS       T00899                                 

Definition
(GenBank) putative penicillin-binding exported protein
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PFLU_1023
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pfs01002]
    PFLU_1023
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfs01011]
    PFLU_1023
Enzymes [BR:pfs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PFLU_1023
   3.4.21  Serine endopeptidases
    3.4.21.-  
     PFLU_1023
Peptidases [BR:pfs01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   PFLU_1023
Peptidoglycan biosynthesis and degradation proteins [BR:pfs01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PFLU_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CAY47287
UniProt: C3K5C8
LinkDB All DBs
Position
1132548..1134092
Genome map
AA seq 514 aa AA seqDB search
MTPCGKPARHRGRELVALPPLTALRTTLLMYFGKCLHTRGMLVGLSLLLGGCASVSQTST
PGTLDHLMADPALNGATVSLMVRDARSGSTLYQHNPRTRVIPASNLKLLTTAAAMDVLGP
QYRFSTQLLGNGTQQGERLSGNLYLRGLGDPTTQFADYQALAAQLAGQGVRQVQGDLVFD
DTWFDAERLGVDWAQDDESTYYGAQISALTVSPNADFDAGTLLVTAKAPVAVGQPVSVVV
SPSTDYVQLNNRAVSGPGNTYGITRQHGTNLLQLTGALAPGKQSRQWVSVWEPTQLVANL
FEQALAQQGIQVLGRRVIGGTSPATARVLAEHQSAPLQELITPLLKLSNNNMSEALLKAM
GRKTANAGTAQAGVAAVADFMRRQGLDPMTLSQVDGSGLSRRNWVSSQNLTDLLLAAAKQ
PWFEAWYNALPIAGDPDRMTGGSLRYRLRGTAAQNNLHAKTGSMAGVSSLSGYITDADGR
RLVFSMISNNYVSDATPIRALENRVALALSQWHD
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacgccttgtggcaagcccgctcgccacagggggagggagctggtagcgttgccgcca
ctgacagctttgcggacaacgctactgatgtactttggaaaatgcttacacacccgcggc
atgctggttggcttgagccttttgctggggggctgcgcgagtgtttcccagacctccacc
ccaggcaccctcgatcacctgatggccgacccggcgctcaacggcgccactgtctccctg
atggtgcgtgacgcccgcagcggcagcacgctctaccaacacaacccgcgaacacgggtc
attcctgcgtccaacctcaaattgctcaccactgcggcggcgatggatgtgctggggccg
caataccggttttccactcaactgctgggtaacggcacccagcagggcgagcgcctcagc
ggcaacctctatttgcgcggcttgggcgacccgaccacgcaattcgccgactaccaggca
ttggcggcacaactggcggggcagggtgtgcgccaggtccaaggcgatcttgtcttcgac
gacacttggttcgacgccgaacggctgggcgtggactgggcccaggacgatgaaagcacc
tactacggcgcgcagatttcggcgctgaccgtgtcgcccaatgcggattttgatgcgggc
acgttgctcgtcacggcgaaggcgcccgtcgcggttggccagccggtgagcgtggtggtg
agcccgtccaccgattatgtgcaactgaacaaccgcgcggtcagcggtcccggtaacacc
tacggcatcacccgccagcacggcaccaacctgctgcaactcacgggtgcgctggcgcca
ggcaaacaaagccggcagtgggtgagcgtgtgggagccgacgcaactggtggccaatctg
tttgagcaggcgttggcgcagcagggcatccaggtactgggccgacgcgtgatcggtggt
acaagcccagcgacggccagggtgctggccgagcatcaatcggcaccgctgcaggaactg
atcacgccgctgctcaaactgtcgaacaacaacatgtccgaggcgttgctcaaggccatg
gggcgcaagacagccaacgcgggtacggcgcaggccggtgtcgcggcagttgcggatttc
atgcggcgccagggtttggacccgatgacgctgagccaggtggacggttcgggtctgtcg
cggcgtaactgggtgtcgtcgcagaacctgaccgacctgctgctggccgcagccaagcag
ccctggttcgaagcctggtacaacgccttgccgatcgccggtgaccccgaccgcatgacc
ggcggcagcctgcgctaccgcctgcgcggcacggcggcgcaaaacaacctgcacgccaag
accggctccatggccggggtttcctcgttgagcggctacatcaccgacgccgatggccga
cgcctggtgttttcaatgatcagcaataactatgtgagtgacgccacgcccatccgtgcg
ctggaaaaccgcgtggcactggcactgagccaatggcacgactag

DBGET integrated database retrieval system