KEGG   Pseudomonas fluorescens SBW25: PFLU_1312Help
Entry
PFLU_1312         CDS       T00899                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs03030  DNA replication
pfs03410  Base excision repair
pfs03420  Nucleotide excision repair
pfs03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pfs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PFLU_1312
   03410 Base excision repair
    PFLU_1312
   03420 Nucleotide excision repair
    PFLU_1312
   03430 Mismatch repair
    PFLU_1312
Enzymes [BR:pfs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PFLU_1312
    6.5.1.6  DNA ligase (ATP or NAD+)
     PFLU_1312
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PFLU_1312
DNA replication proteins [BR:pfs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PFLU_1312
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PFLU_1312
DNA repair and recombination proteins [BR:pfs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PFLU_1312
   NER (nucleotide excision repair)
    Other NER factors
     PFLU_1312
   MMR (mismatch exicision repair)
    Other MMR factors
     PFLU_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: CAY47568
UniProt: C3K7I7
LinkDB All DBs
Position
complement(1449866..1451500)
Genome map
AA seq 544 aa AA seqDB search
MKAFAELYANLDATTSSNAKLAALQAYFRHAAPEDAAWAVYFLSGGRPRQLVPTRLLRDM
ATEASGIEPWLFEESYQSVGDLAETISLLLPESPYTSEDGLAVWLEEKLLPLRGLPPLDL
AARLPALWAQLDQPSLMVCIKLITGSFRVGVSKLLVTRALAAMAELDSKRVAQRLVGYTD
LSNRPTPEGYLKLIAPESSDEHAQRGGQPYPFFLAHGLAQPVEQFDTLLGSPADWQVEWK
WDGIRAQLVKRDGRLWIWSRGEELVTERFPELHSLVSGLPDGTVIDGEIVVWKDAVQPFA
QLQQRIGRKTLSKKVLEDAPVAVLAYDLLEHQGDDWRNHTQAERRAQLEQVIAGCNQPVL
LASPLLTANSWQDLAEQREASRSLGVEGMMLKARDGLYGVGRTKDMGVWWKWKVDPFSVD
AVLIYAQRGHGRRASLYSDYTFAVWDGPSGSERTLVPFAKAYSGLTDEEMRKVDAIVRKT
TVEKFGPVSSVTPSMVFELGFEGIALSKRHKSGIAVRFPRMLRWRQDKSVEDADNLATLQ
DLLT
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttcgccgagctgtacgccaacctcgacgccaccacctcgagcaacgccaag
ctggcggcgctgcaggcgtactttcgccatgccgcgccggaagatgcagcctgggccgtg
tactttctgtccggcggacggccgcggcaattggtacccacgcgtctgttgagggacatg
gccaccgaagcgtccggcatcgagccgtggctgtttgaagagagctaccagtcggtgggc
gacctggcggagaccatttccctgctgctgccggaatccccctacacctcagaggacggt
ctggcggtgtggctggaggaaaaactcttgcctctgcgtggcctgcctccgctggacttg
gcagcgcggctccctgcgttatgggcgcaactggatcagccgagcctgatggtgtgcatc
aagttgatcaccggcagttttcgtgtgggcgtgtcgaagttgctggtcacccgcgccctt
gccgcgatggccgaactcgacagcaagcgcgtggcccagcggttggtgggctacaccgat
ctgtccaatcgccctacgcctgagggctacctcaagctgatcgcccctgaatcgtccgac
gaacatgcgcaacggggcgggcagccttatccgttttttctcgctcacggcttggcgcaa
ccggtggagcagttcgacaccttgctgggctctcccgccgattggcaggtcgagtggaag
tgggatggcatccgtgcgcagttggtcaagcgtgacggccgtctgtggatctggtcacgg
ggtgaagagctggtgaccgagcgcttccccgaactccacagcctggtgagcggcttgccc
gacggcacggtgatcgacggcgagatcgtggtgtggaaagacgcggtgcaacccttcgct
cagttgcaacagcgcatcggccgcaaaaccctgagcaaaaaggtactggaggatgccccg
gtcgcggtcctggcgtacgacctgctggaacatcagggtgacgactggcgcaaccacacc
caggccgagcgccgcgcccagcttgagcaggtgattgccgggtgcaaccagcctgtattg
ctggcgtcccctttgctgacggcaaacagttggcaggacctggcagaacagcgcgaagcc
tcccgcagcctcggcgtggaaggcatgatgctcaaggcgcgtgatgggctgtacggcgtg
ggccgcaccaaggacatgggcgtgtggtggaagtggaaggtcgacccgttcagcgtcgac
gcggtgttgatctacgcccaacgcggccacggccgacgcgccagtctctacagcgactac
accttcgcggtgtgggacggcccgtccggcagcgaacgtacgctggtgccctttgccaag
gcctactcagggctgaccgacgaagagatgcgcaaggtcgacgcgattgtgcgcaagacc
acggtggaaaagttcggcccggtgagcagcgtgacgccgagcatggtgtttgaattgggg
tttgaagggattgccctgtccaagcggcataagagcgggattgcggtgcggtttccacgg
atgttgcgctggcggcaggataaatctgtggaagacgctgacaacctcgccaccctgcaa
gacctcctgacctga

DBGET integrated database retrieval system