KEGG   Pseudomonas fluorescens SBW25: PFLU_1922
Entry
PFLU_1922         CDS       T00899                                 

Definition
(GenBank) putative exported protein
Organism
pfs  Pseudomonas fluorescens SBW25
SSDB
Motif
Pfam: Lzipper-MIP1
Other DBs
NCBI-ProteinID: CAY48167
UniProt: C3K5N8
LinkDB
Position
complement(2098330..2099712)
AA seq 460 aa
MSRLLARPWLAVEGLLLCGLFAMATHAHAAEGDYRLGTQGEVLDDRVMYTIGGGSAVGSP
SSLYRPSALGVGGSWRANMMCGNMSLTNTLQNQLNGVTEGFQQIMGSIVQNATQAVMSLP
ALIIQRANPGLYELLSNGVMQGRIDFDRSKLTCQAMAEKMADKVGQAGWGALAKNQEMQG
NLEQTGGDAVAAVKHTETHNGNNGVSWVGGSKAGGSGQTPIRVTSDVVRAGYNLLHNRSA
DDSASISSNDCLGGAICQTWTSPQEESEWAVRVLGETEVATCDSCETLRATAGSGLTPLI
QEAYSERLKALQGLLSGSLPPTPDNLAKASSPMLPVTRGVIEALRDDPDQDLLTRRLASE
TALSSVLDKALLLLRTLLAGSYEPNIASAEPAQTALTKNIDTLEREIRLLQTELQVRQML
ATNTASLVLDRHAGGADASRAVEQGDPEPGRLNDADARRK
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgagtcggcttctcgcgcgaccatggcttgccgtggagggcctgctgctctgtggattg
ttcgccatggccactcatgcccacgctgctgaaggtgattaccgcctgggcacccagggc
gaagtactcgacgaccgggtgatgtacaccattggtggcggctcggcagtcggctcaccg
agttcgctctaccgacccagtgctcttggtgtcggtgggtcatggcgagcgaacatgatg
tgcggaaacatgagcctcaccaacaccctgcaaaaccagttgaacggcgtcaccgaaggt
ttccagcagatcatgggcagcatcgtgcagaacgcgacccaagccgtgatgtcgctaccg
gcgttgatcatccagcgcgccaaccccggcctctatgagttgctcagtaacggggtgatg
caaggccgtatcgacttcgaccgctccaagctgacctgccaggccatggccgagaagatg
gcggacaaggtcggtcaagccggctggggcgcgctggccaagaaccaagaaatgcagggc
aatctggagcaaaccggcggtgatgcggtggctgcggtaaaacataccgagacccataac
ggcaacaatggggtgtcttgggtcggcggctcaaaggctggaggtagtgggcagacaccc
attcgagtgacctccgacgtagtgcgagcaggctacaacctgctgcataaccggtcggcg
gatgacagtgcctcgatcagtagcaacgactgcctgggtggggccatttgccagacttgg
acctcgccccaggaagagtccgaatgggcagttcgcgtgttgggcgagaccgaagtcgca
acctgcgacagctgcgaaaccctgcgtgcgaccgctggcagcggactgacgccgctgatt
caggaggcctacagcgaacgcctcaaggccctgcaagggctgctgtcgggctcactgccg
cctacccctgacaacctggctaaagcctcgagcccgatgctgccggtgacccgtggcgtg
attgaagccctgcgcgatgaccccgaccaggatctgctgacacgacgcctggccagcgag
acggccctatccagcgtactcgacaaggcactgctgctactgcgtacgctactggcgggc
agttacgaaccgaacatcgcctccgccgagccggcccagaccgccttgacgaaaaacatc
gacacactggagcgcgaaatacgcctgctgcagaccgaactgcaggtccggcagatgttg
gccaccaacaccgccagcctggtgctcgatcggcatgccggtggtgccgatgcttcgcgt
gccgtcgagcaaggcgaccccgagcccggtcgactcaatgacgctgacgcccggcgtaag
tga

DBGET integrated database retrieval system