KEGG   Pseudomonas fluorescens SBW25: PFLU_1997Help
Entry
PFLU_1997         CDS       T00899                                 

Gene name
accC
Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00061  Fatty acid biosynthesis
pfs00620  Pyruvate metabolism
pfs00640  Propanoate metabolism
pfs01100  Metabolic pathways
pfs01110  Biosynthesis of secondary metabolites
pfs01120  Microbial metabolism in diverse environments
pfs01130  Biosynthesis of antibiotics
pfs01200  Carbon metabolism
pfs01212  Fatty acid metabolism
Module
pfs_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFLU_1997 (accC)
   00640 Propanoate metabolism
    PFLU_1997 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PFLU_1997 (accC)
Enzymes [BR:pfs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PFLU_1997 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PFLU_1997 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CAY48240
UniProt: C3K7R1
LinkDB All DBs
Position
2167600..2168973
Genome map
AA seq 457 aa AA seqDB search
MTQAIQKLLVANRGEIAVRIIRAAKALGIPTVAACSEADVDSRAARMADEVHLLGPARAD
KSYLNVEALLGALKATGANAVHPGYGFLSENADFAEAVLAAGAIFVGPSPETIRRMGDKA
EARRTAQEAGVPVVPGSPGELFDVESALKAAEAVGFPLLIKASAGGGGRGIRLAENAEQL
AEEFPRSQREAQAAFGNGAVYLERFISRARHIEVQVLGDGQHAVHLFERECSLQRRRQKI
FEEAPSPALNPQQRETLCTSAVRLTESLGYKGAGTLEYLYDDVTGEFFFIEMNTRIQVEH
PVSELITGIDLVQAMLRIAGGEPLGFKQSDIQLNGAALQMRLNAEDPERDFFPSPGLVES
LIWPQGEGVRVDTHLYQGYRVPPYYDSLLAKLIVHGRDRAEALTRARLAVKHTTLSGMAT
TLSLHGELLEQPWLHSADFHTGTLETWLAERGRGGQA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccattcaaaaattgctggtcgccaaccgtggcgagatcgctgtgcggatt
atccgtgctgccaaagcactggggattcccacggttgccgcgtgcagcgaagcggacgtc
gattcccgggcggcgcgcatggccgacgaggtgcaccttctcggtccggcccgcgctgac
aagagttacctgaacgtcgaggcattgctcggcgccctgaaagccacgggcgccaacgcg
gtccatccgggttatggctttctctcggaaaacgccgacttcgccgaggcggtgctggcg
gccggggccattttcgtcggcccgagcccggagacgatccggcgcatgggcgacaaggcc
gaagcccggcgcaccgcgcaggaagcgggcgtgcccgtggtgcccggttcgcccggtgaa
ctgttcgatgtcgaatcggcgctcaaggccgccgaagccgttggctttccactgttgatc
aaagcctcggccggcggtggcgggcggggtattcgcctggcggaaaacgccgaacaactg
gctgaagagttcccccgatcccagcgcgaagcccaggctgcgttcggcaacggcgcggtg
tacctggagcgcttcatcagccgcgcacggcacatcgaagttcaagtgttgggcgacggt
cagcacgcggtgcacttgtttgagcgtgagtgttcgttgcaacgtcgtcggcagaagatt
ttcgaggaagcgccatcgccggccctcaacccgcagcaacgcgagacgctctgcaccagc
gccgtgcgcctcaccgagtccctgggctacaagggcgccggcacactggaatacctatat
gatgacgtgaccggcgagttcttttttatcgagatgaacacgcggattcaggtcgagcat
ccggtcagtgaactgataaccggcatcgacctagttcaggcgatgttgcgcattgccggt
ggcgagccgctgggcttcaagcaaagcgacatccagctcaatggtgccgccctgcaaatg
cgcctgaacgccgaagacccggagcgggatttcttccccagccccggtctggtcgaatcg
ttgatctggccgcaaggcgagggcgttcgggtcgacacccatctctatcaaggctaccgc
gtgccgccgtactatgactcgctgctggccaagctgattgtccatggtcgtgatcgtgcc
gaggccttgactcgcgcacggctggcagtgaagcacaccacgctctccggcatggccacc
accttgtcgctgcacggcgaattgctggaacaaccgtggttgcacagcgccgacttccac
accggcaccctggaaacctggttggccgagcgtggccgtggaggtcaagcatga

DBGET integrated database retrieval system