KEGG   Pseudomonas fluorescens SBW25: PFLU_2375Help
Entry
PFLU_2375         CDS       T00899                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00010  Glycolysis / Gluconeogenesis
pfs00052  Galactose metabolism
pfs01100  Metabolic pathways
pfs01110  Biosynthesis of secondary metabolites
pfs01120  Microbial metabolism in diverse environments
pfs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFLU_2375
   00052 Galactose metabolism
    PFLU_2375
Enzymes [BR:pfs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PFLU_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAY48608
UniProt: C3K973
LinkDB All DBs
Position
complement(2588531..2589679)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLAMSLLIASGGAQAAGLTSEHKPFGKTNDGTAVEQYILRNSHGMQATVIT
YGGVLQSLKVPDKNGKVDDVVLGFDDVQGYQAGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKHVWKASPVKSKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDKNELHIDYKATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGELAPVKGTPMDFLKPTPIGQHIKEDHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLYTSEPGVQFYTSNFLDGSVKGKAGKTYLHWSGFTLETQHFPDAPNQPTF
ASTRLNPGQTYTQSTVFKFSAN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgatacctgctctcgggcctggccatgtccttgctgatcgccagtggc
ggcgcccaggccgcagggctcaccagcgaacacaaaccgtttggtaaaaccaacgacggc
accgccgtcgaacagtacatcttgcgcaacagccacggcatgcaagccacggtgatcacc
tacggcggcgtgctgcagtcgctgaaagtgccggataaaaacggcaaggtcgacgacgtg
gtactcggcttcgacgacgtgcagggctaccaggctggcaccgcgtttttcggtgcgacc
atcgggcgtttcggcaatcgcctcgcgggcggtgcctttgagctcgacggcaagcgctac
caggtgccactcaacgacggccccaactcgctgcacggcggcgcacaaggcttcgacaag
cacgtttggaaggcctcgcccgtcaaatccaaggactcggtcggcgtcaccctcacctac
ctgtccaaggacggtgaaatgggcttccccggcaacctgaaaaccgaagtcacctatcgc
ctcaacgataaaaacgaactgcacatcgactacaaggccaccaccgacaaacccacagtg
ctcaacctcaccaaccacagctacttcaacctcgccggcgcggggaatggcgacattctc
aagcaggtcgccaccttgcatgccagccattacaccccggtgaatgccaccttgattccg
accggcgaactggcccccgtcaagggcacgccgatggacttcctcaaaccgacgccgatc
ggccagcacatcaaggaggatcatccgcagctcaaatttgccgagccgaaacaaggcggg
tttgacttcaactgggcgctggacaccaaaggcgacgtcaagcaattggccgccgaggtg
catgatcctgagtcaggtcggcgcttgcagctgtacaccagcgagccaggggtgcagttc
tataccagtaacttcctcgacggttcggtgaagggcaaggctgggaagacctacctgcac
tggagtggtttcaccttggagacccagcactttccggatgcgcctaaccaaccgacattt
gcctccacccgcctgaacccagggcaaacctacacccagagcaccgtcttcaaattctcc
gcaaactaa

DBGET integrated database retrieval system