KEGG   Pseudomonas fluorescens SBW25: PFLU_3964Help
Entry
PFLU_3964         CDS       T00899                                 

Definition
(GenBank) 2-oxoisovalerate dehydrogenase alpha subunit
  KO
K00166  2-oxoisovalerate dehydrogenase E1 component alpha subunit [EC:1.2.4.4]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00280  Valine, leucine and isoleucine degradation
pfs00640  Propanoate metabolism
pfs01100  Metabolic pathways
pfs01110  Biosynthesis of secondary metabolites
pfs01130  Biosynthesis of antibiotics
Module
pfs_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PFLU_3964
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLU_3964
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     PFLU_3964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh OxoDH_E1alpha_N SusD-like DUF3390
Motif
Other DBs
NCBI-ProteinID: CAY50355
UniProt: C3JYV9
LinkDB All DBs
Position
4376986..4378221
Genome map
AA seq 411 aa AA seqDB search
MNQPYEPLRLHVPEPSGRPGCKTDFTYLRLTDAGLVRKPAIDVEPADTADLAKGLIRVLD
DQGQALGPWADGVPVEILRKGMRAMLKTRIFDNRMVVAQRQKKMSFYMQSLGEEAIGSAQ
ALALNIDDMCFPTYRQQSILMARDVPLVDLICQLLSNERDPLKGRQLPIMYSVKDAGFFT
ISGNLATQFVQGVGWGMASAIKGDTKIASAWIGDGATAESDFHTALTFAHVYRAPVILNV
VNNQWAISTFQAIAGGEATTFAGRGVGCGIASLRVDGNDFIAVYAASAWAAERARRNLGP
TLIEWVTYRAGPHSTSDDPSKYRPADDWSHFPLGDPIARLKQHLIKIGQWSEEEHAAVSA
ELEAEVIAAQKQAEQYGTLAGGQIPSAATMFEDVYKEMPEHLKRQRQALGI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagccgtacgaaccgctgcgcctgcacgtccctgaaccctcgggacgcccaggc
tgcaagaccgacttcacctacctgcgcctgaccgacgccggcctggtgcgcaaacccgcc
atcgacgtagaacccgccgacaccgccgacctcgccaaaggcctgatccgcgtgctcgac
gaccagggccaggccctcggcccctgggctgacggtgttcccgtcgagatcctgcgcaaa
ggcatgcgcgcgatgctcaagacgcggattttcgataaccgcatggtcgtcgcccagcgt
cagaaaaaaatgtcgttctacatgcaaagccttggcgaagaagccatcggcagcgcccag
gccctggccttgaacatcgacgacatgtgcttccccacctaccgccagcaaagcatcctg
atggctcgcgacgtgcccctggtggacctgatctgccagttgctgtccaacgagcgtgat
ccgctcaagggccgccagttgccgatcatgtattcggtgaaagacgctggcttcttcacg
atctccggcaacctcgccacccaattcgtacaaggcgtgggctggggcatggcctcggcg
atcaagggcgataccaagatcgcctccgcctggatcggcgacggcgccaccgccgaatcc
gacttccacactgccctcacctttgcccacgtgtaccgcgcgccggtgatcctcaacgtg
gtcaacaaccagtgggccatctccaccttccaagccatcgccggcggcgaagccaccacc
tttgccggacgcggcgtaggttgtggtattgcctccctgcgcgtggacggcaacgacttc
atcgcggtatacgccgcttccgcctgggctgccgaacgtgcgcgccgcaacctcggaccc
acgctgatcgaatgggtcacctaccgtgccggcccgcactccacctcggatgatccatcc
aaataccgccccgccgatgactggagccacttccccctcggcgacccgattgcccgcctc
aagcagcacctgatcaagattggccagtggtccgaagaggaacacgcggcggtcagtgcc
gaactagaagccgaagtgattgcggcgcaaaaacaagccgaacagtacggcacccttgcc
ggcggccagattccaagcgccgcgaccatgttcgaagacgtctacaaagagatgccggag
cacttgaagcgccagcgtcaagcgttggggatctga

DBGET integrated database retrieval system