KEGG   Pseudomonas fluorescens SBW25: PFLU_4601Help
Entry
PFLU_4601         CDS       T00899                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pfs  Pseudomonas fluorescens SBW25
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfs03009]
    PFLU_4601
Enzymes [BR:pfs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     PFLU_4601
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     PFLU_4601
Ribosome biogenesis [BR:pfs03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PFLU_4601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 THUMP Methyltransf_25 Methyltransf_11 Methyltransf_24 Methyltransf_15 PrmA PRR20
Motif
Other DBs
NCBI-ProteinID: CAY51346
UniProt: C3K016
LinkDB All DBs
Position
complement(5074824..5077112)
Genome map
AA seq 762 aa AA seqDB search
MLKSLDCPMSDRFELFLTCPKGLEGLLIEEAVGLGLEEAREHTSAVRGMADMETAYRLCL
WSRLANRVLLVLKRFPMKDAEDLYHGVLDIEWADHMVPDGTLAVEFSGHGSGIDNTHFGA
LKVKDAIVDKLRTPAGERPSIDKINPDLRIHLRLDRGEAILSLDLSGHSLHQRGYRLQQG
AAPLKENLAAAILIRSGWPRIAAEGGALTDPMCGVGTFLVEGAMIAADMAPNLNRELWGF
TTWLGHVPALWKKLHTEATERAAIGMNKPPLWVRGYEADPRLIQPARNNIERAGLSHWIK
VYQGEVGTFEPRPDQNQKGLVICNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVF
TGAPDLGKRMGIRSHKQYSFWNGALPCKLLLIKVNPDQFVTGERRTPEQRQAEREQAAYD
QAPVEPQERQYNKNGNPIKPAPAPVVEQARLSEGGQMFANRLQKNLKLLGKWAKREGVDC
YRVYDADMPEYSMAIDLYHDWVHVQEYAAPKSIDPEKASARMFDALAAIPQALNIDKSRV
VVKRRERQSGTKQYERQSAQGKFTEVSEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQKEA
AGKRFLNLYCYTATASVHAAKGGARSTTSVDLSKTYLDWARRNFSLNGFSDKNRLEQGDV
IAWLEASRDEFDLIFIDPPTFSNSKRMEGIFDVQRDHVQLLDLAMARLAPGGVLYFSNNF
RKFVLEDNLSERYAVEEISDKTLDPDFARNAKIHRAWKITAR
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaaaagcctggattgccccatgtcggaccgttttgaactcttcctcacttgcccc
aagggcctcgaaggcctgctgatcgaggaagccgtcgggcttggccttgaggaagcccgc
gagcacacctcggccgtgcgcggcatggccgacatggaaaccgcctaccgcctgtgcctc
tggtcgcgactggccaaccgcgtgctgctggtgctcaagcgcttcccgatgaaggacgcc
gaagacctctaccacggcgtactggatatcgagtgggccgaccacatggtgccggatggc
accctggcggttgagttcagcggccacggttctggcatcgacaacacccacttcggtgcg
ctgaaggtcaaggatgcgatcgtcgacaagctgcgcaccccggccggcgagcgcccgtcc
atcgacaagatcaacccggacctgcgcatccacctgcgcctggaccgtggcgaagccatc
ctgtccctcgacctgtccggccacagcctgcatcagcgtggctaccgcctgcagcagggc
gcggcaccgttgaaggaaaacctggccgccgcgatcctgattcgttcgggctggccgcgc
attgctgccgaaggcggcgcgctgaccgacccgatgtgcggcgtcggtaccttcctggtc
gaaggcgcgatgattgctgccgatatggcgcccaacctgaatcgcgaactgtggggcttc
accacctggctcggtcacgtcccggcgctgtggaagaagctgcacactgaggcgactgag
cgcgcggccatcggcatgaacaagccgccgctgtgggtgcgtggctatgaagctgatcct
cggctgatccaacccgcgcgcaacaacattgagcgcgccggcctgagccactggatcaag
gtgtaccagggcgaagtcggtaccttcgagccgcgcccggaccagaaccagaaaggcctg
gtcatctgcaacccaccgtacggcgagcgcctgggtgacgaagccagcctgttgtacctc
taccagaacctcggcgagcgtttgcgccaagcgtgcatgggctgggaggcggcggtgttc
accggcgcgccggacctgggcaagcgcatgggcattcgcagtcacaaacagtattcgttc
tggaacggcgcgttgccgtgcaaattgctgctgatcaaggtcaaccctgaccagttcgtc
actggcgagcgtcgcaccccggagcagcgccaggccgagcgtgagcaagccgcttacgat
caagccccggtcgagccgcaagagcgtcagtacaacaagaacggcaacccgatcaaaccc
gccccggcaccggtggtcgagcaggcgcgcctgagcgaaggcgggcagatgtttgccaac
cgcctgcagaagaacctcaagctgctgggtaagtgggccaagcgtgaaggcgtggattgc
taccgtgtgtacgacgccgacatgccggaatattccatggccatcgacctgtaccacgat
tgggtccatgtacaggaatacgccgcaccgaagtccattgacccggaaaaagcctccgcg
cgtatgttcgatgccttggcggcgattccccaggcgctgaacatcgacaagagccgtgtg
gtggtcaagcgtcgcgagcgtcagagcggcaccaagcagtatgagcgccagagcgcccag
ggcaagttcactgaagtcagcgaaggcggcgtgaagctgctggtcaacctcaccgactac
ctggacaccggcctgttcctcgaccaccgtccgatgcgcatgcgcatccagaaggaagcg
gccggcaagcgcttcctcaacctgtattgctacaccgccaccgccagcgtgcacgcggcc
aagggcggcgcgcgcagcactaccagcgtcgatttgtccaagacttacctggactgggcg
cgtcgcaacttctccctcaacggtttctccgacaagaaccgtctggagcagggtgacgtg
atcgcgtggctggaggccagccgtgatgagttcgacctgatcttcatcgacccgccgacc
ttctccaactccaagcgcatggaaggcatcttcgacgtacagcgcgaccacgtgcagttg
ctcgacttggccatggcccgcctggcgccgggtggcgtgctgtacttctcgaacaacttc
cgcaagtttgtgctcgaggacaacctcagcgagcgctatgcggtcgaggaaatcagcgac
aagaccctcgacccggatttcgcgcgtaacgcgaagatccaccgggcgtggaaaatcacc
gcgcgctga

DBGET integrated database retrieval system