KEGG   Pseudomonas fluorescens SBW25: PFLU_4661Help
Entry
PFLU_4661         CDS       T00899                                 

Definition
(GenBank) putative fatty acid oxidative multifunctional enzyme
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs00071  Fatty acid degradation
pfs00280  Valine, leucine and isoleucine degradation
pfs00281  Geraniol degradation
pfs00310  Lysine degradation
pfs00362  Benzoate degradation
pfs00380  Tryptophan metabolism
pfs00410  beta-Alanine metabolism
pfs00640  Propanoate metabolism
pfs00650  Butanoate metabolism
pfs00903  Limonene and pinene degradation
pfs00930  Caprolactam degradation
pfs01100  Metabolic pathways
pfs01110  Biosynthesis of secondary metabolites
pfs01120  Microbial metabolism in diverse environments
pfs01130  Biosynthesis of antibiotics
pfs01200  Carbon metabolism
pfs01212  Fatty acid metabolism
Module
pfs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PFLU_4661
   00650 Butanoate metabolism
    PFLU_4661
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFLU_4661
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLU_4661
   00310 Lysine degradation
    PFLU_4661
   00380 Tryptophan metabolism
    PFLU_4661
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFLU_4661
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PFLU_4661
   00281 Geraniol degradation
    PFLU_4661
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFLU_4661
   00930 Caprolactam degradation
    PFLU_4661
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PFLU_4661
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PFLU_4661
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PFLU_4661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 UDPG_MGDP_dh_N AlaDh_PNT_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAY51445
UniProt: C3K0T7
LinkDB All DBs
Position
complement(5138890..5141037)
Genome map
AA seq 715 aa AA seqDB search
MTQAIRYEKGQDGIVVLTLDMPGQSANTMNSVYREAMAATIERLEAEKDGLAGVVITSAK
KTFFAGGDLNELIKVDTAHATAFYDSVLVLKAQLRRLETLGKPVVAAINGAALGGGWEIC
LACHYRVALDDKSVQLGLPEVTLGLLPGGGGVVRMVRSLGLEKALPYLLEGKKVRPQQAL
QAGLVNELAADREALLAKSRAWILANPDAKQPWDNKAYQIPGGTPSSPKVAQMLAIAPSI
LRSKTQGCFPAPEKILCAAVEGAQVDFDTAHLIETRYFTELVTGQVAKNMIGTFWFQLNE
INAGRSRPQGFAPYVTRKVGVLGAGMMGAGIAYVSASAGIDVVLKDVNLAAAEKGKAHSV
ALLDKKVSRGQLTAQQREATLARIHPTASDADLAGCDLIIEAVFEDRELKAKVSAAAQSV
VGAEAVIASNTSTLPISGLATAVPDQAKFIGLHFFSPVDKMPLVEIIKGTHTSDETLARG
FDFVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVAAPMIETEARKAGMPVGPL
AVSDEVSLSLMSHIRQQTSKDLQAEGKAVPTHPATAVIDLLVNEYKRVGKAAGGGFYEYP
SGGQKYLWPELKSRFERPDQRISPQDVRDRLLFIQAIETVRCVEEGVLMSTADANVGSIF
GIGFAAWSGGALQFINQYGLNDFVARARYLAEQYGERFAPPTLLLDKAARGEVFR
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagccattcgttacgaaaaaggccaggacggtatcgtcgtgctgaccctcgac
atgcccggccagagcgccaacaccatgaacagcgtgtaccgcgaggccatggcggccacg
atcgaacgcctggaggcggaaaaagacggccttgccggggtggtcatcacctcggccaag
aagacattttttgcgggtggcgacctgaatgaactgatcaaggtcgacacggctcacgcc
acggcattttacgacagcgtgttggtgttgaaggcacaactgcggcgcctggaaaccctc
ggcaagcccgtggtggccgccatcaatggcgcggcgctgggaggcggctgggagatttgc
ctggcctgccattaccgtgtcgcgctggacgacaaatcagtgcagcttggcctgccggaa
gtcaccctgggcctgctgccgggtggcggtggggtggtgcgcatggtgcgttcgctgggg
ctggaaaaggccttgccgtatttgctcgaaggcaagaaagtgcggccgcaacaggcactg
caagccggtctggtcaatgagctggcggcggaccgcgaagcgttgctggccaagtcacgc
gcctggatcctggccaatccggacgccaaacagccgtgggacaacaaagcctaccagatc
cccggcggtacgccgtcgagcccgaaagttgcccagatgctggcgatcgcgccatcgatt
ttgcgcagtaaaacccagggctgtttccccgccccggagaaaatcctctgcgctgccgtc
gaaggcgcccaagtggacttcgacaccgcacacctgatcgaaacccgttatttcaccgag
ttggtgaccgggcaggtggcgaaaaacatgatcggcactttctggttccagctcaacgag
atcaacgccggccgttcacggccgcaagggtttgcaccctatgtcacacgtaaagtcggc
gtgctgggtgcggggatgatgggggcggggatcgcttacgtcagcgccagcgcaggcatc
gacgtggtactcaaggacgtcaacctggccgccgccgagaagggcaaggcacattcggtg
gcgttgctggacaagaaggtcagccgtggtcagttgacggcgcaacagcgtgaagccacc
ttggcgcgtattcatcctacggcctccgatgcagacttggcgggttgcgacctgatcatc
gaggcggtgttcgaagaccgcgaactcaaggccaaggtctcggctgctgcgcaaagcgtg
gtcggcgccgaggccgtgatcgcctccaacacgtccaccttgccgatcagcggtttggcc
acggcggtgccggatcaggccaagttcatcggcctgcacttcttcagcccggtggacaag
atgcccttggtggaaatcatcaagggtacccacaccagcgacgaaaccctggcgcgaggg
ttcgatttcgtactgcaaatcaagaaaactccgatcgtggtcaacgacagtcgtggcttc
ttcacctcgcgggtgttcggcaccttcaccaatgaaggcatcgccatgctcggcgaaggc
gtggccgcgccgatgatcgagaccgaagcccgcaaggccggcatgccggtggggccgttg
gcggtgtcggatgaagtctccctcagcctgatgagccatatccgacagcagacgtccaag
gatctgcaggcagaaggcaaggccgtgccgacacacccggcgacggcagtgatcgatctg
ttggtcaacgaatacaagcgcgtaggcaaggcggcggggggcggtttctatgaatacccc
agcggtgggcaaaagtacctgtggccagagttgaaaagccgctttgaacggcccgaccaa
cgcatctcgccacaggatgtgcgcgaccgcctgctgtttatccaggccatcgagaccgtg
cgctgtgtggaggagggggtgttgatgtccacggcagacgcgaacgtggggtctattttc
ggcatcggtttcgcggcctggagcggcggcgctctgcagttcatcaaccaatatgggttg
aacgactttgtcgcccgcgctcgttacctggccgagcaatatggcgaacggttcgcaccg
ccgacattgttgttagataaagcggcacgcggtgaagtgttccggtga

DBGET integrated database retrieval system