KEGG   Pseudomonas fluorescens SBW25: PFLU_4855Help
Entry
PFLU_4855         CDS       T00899                                 

Definition
(GenBank) putative superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Brite
Enzymes [BR:pfs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PFLU_4855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAY51733
UniProt: C3JZ86
LinkDB All DBs
Position
5333044..5333640
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLAPNAGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNVRPKYVEAFWN
LVNWKFVAEQFEGKTFTA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccctacgcacacgatgccctgcagccgcacatttcc
aaggaaaccttggaataccaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtcccaggcaccgagttcgaaggcaagaccctggaagagatcgtcaaatcctct
tcgggcggtatcttcaacaacgccgctcaggtctggaaccacaccttctactggaactgc
ctggcgccaaacgccggcggtcaacccaccggcgcgctggctgaagccatcaacgctgcg
ttcggttcgttcgacaagttcaaggaagagttcaccaagacgtccgtcggcaccttcggt
tccggttggggctggctggtgaaaaaggctgacggttccctggccctggccagcaccatc
ggcgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtgtgggaa
cacgcttactacatcgactaccgtaacgtgcgtccaaagtatgtggaagcgttctggaac
ctggtcaactggaagttcgtggctgagcagttcgaaggcaagaccttcactgcctaa

DBGET integrated database retrieval system