KEGG   Pseudomonas fluorescens SBW25: PFLU_6010Help
Entry
PFLU_6010         CDS       T00899                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
pfs  Pseudomonas fluorescens SBW25
Pathway
pfs02025  Biofilm formation - Pseudomonas aeruginosa
pfs03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PFLU_6010
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFLU_6010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfs01001]
    PFLU_6010
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfs02044]
    PFLU_6010
Enzymes [BR:pfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PFLU_6010
Protein kinases [BR:pfs01001]
 Serine/threonine kinases: Other
  Bacterial family
   PFLU_6010
Secretion system [BR:pfs02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PFLU_6010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal TssR VWA_2 Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: CAY53548
UniProt: C3K498
LinkDB All DBs
Position
complement(6566154..6569129)
Genome map
AA seq 991 aa AA seqDB search
MNIVIPGYDIEGEIGEGAMASVYLATQRSLERKVALKVMAAALAADPSFCERFLREGKTL
ARLSHPHTVTIHDIGNVGELYYMAMEYLPNGTLKERIAAGLTPEQGVTLIRQIASALGYA
HAQGLVHRDVKPANILFRADGTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVLYEILVGKLPYSGTDALSTALAHLTEPLPELPVHHGRYQEVLRKL
LAKDPAERFPDAAALLQALDNLPAESPEATLVRPLPIPLSFDLAGMTPVTIDIPTDKPQP
QPVARQPVVTPTQHNAVSEQRRGPVMALAAVAVAVALAIGGASYWWLSGSDKPVAKPPAA
VVPTVAPPVPDVDGGQRPLLMAGKKTLFQRVLSKPGAKLSSDAGSAPGKALPAFSVLYVY
QRKDVDGSPWVRVGAATDGRSDGWLPASHVSDWKQSLVLKFTERSGRAPVMFLRQSGEVE
KLLADPAAAKGVLAKAQKNSEDNSQILALEPTASAVPQNQFYLLPIFDSKETFDENGQPV
QLLNVASIDPGSSAAAKPSTPVIKANADAFRTAVVLVVDTTVSMQPYIDQIRDVVHELQT
RIAERGELDSVSFGMVGFRSSIKKTPGLEYVAKTLISLDQGRDPQRFLDMARQVKASTVS
SHSFNEDAFAGVMQAVDGMDWSGYGGRIILLVTDAGALRKNDPFAATQMNEAEVRQAALG
KQIKIYALHLRTDAGKKTHAGAESQYRILTADANPQIGDLYTPVPGGDVRKLGERVDEIG
TVFANLVHQVRSNTPQPVPLLSSAPTLADKSAAVGYAMHMDFLGRKAASQAPQLVSAWTA
DRDLTNPALPAFQVCVMLTKLQLNDLQQSLKLIVDAARKTQTSPKDFFQEIASASAYMSR
DPQALRKGGNLADGGILGEYLEGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELDSKIRLY
ETFHNDVANWVRFGDAEPGDALYRVPLSTLP
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtcatccccggctacgacatcgaaggcgagatcggcgaaggcgccatggcc
agcgtgtacctggcgacccagcgctcgctggagcgcaaggtggcgttgaaggtgatggcg
gcggcgctggcggccgacccgagcttctgcgaacgcttcctgcgcgagggtaagaccctg
gcgcgcttgtcgcacccgcacacggtgaccatccatgacatcggcaacgtcggtgagctg
tattacatggccatggaatacctgcccaacggtacgctcaaggagcgcatcgccgcaggg
ttgacgccggagcagggtgtgacgctgattcgccagatcgcctcggcgctgggctatgcc
catgcccaagggctggtgcaccgcgatgtgaaaccggcgaacattctgtttcgcgctgat
ggcacggcggtgctgtccgactttggtatcgccaagtcgctggacgaccgcacccagttc
acccaggccgggtttgccgtgggcacgccgagctacatgagcccggaacaggcgcggggc
caggagatcgacggccgtgccgacctgtacgcgttgggtgtggtgctgtatgaaattctc
gtcggcaagctgccgtatagcggcaccgacgcgctgtccacggcattggcgcacctgact
gagccattgccggaactgccggtgcaccacggtcgctaccaggaggtgctgcgcaagctg
ttggccaaggacccggcggaacggttcccggatgcagcggcgttgttgcaggccctggat
aacctgccggcggagtcgccggaggccaccttggtgcggccgctgcccatcccgctgagc
ttcgacctggcgggcatgaccccggtcactatcgatattccgaccgataaaccacagccg
caacctgtcgcgcgccagccggtggtgacaccgacgcaacacaacgccgtgtccgagcag
cgccgtgggccggtgatggcgctggcggcggttgcggtggcggtggccttggccatcggt
ggtgccagttactggtggttgagcggtagcgataagcccgtcgccaagccgccggctgcg
gtggtgccgacggtggcgccgcctgttcccgacgtcgacggcggccagcgtccgttattg
atggcaggtaagaagacactgttccagcgcgtcctgagtaagccgggcgccaagctttcc
tctgacgcaggcagcgcgccgggcaaagccctgccggcgttttccgtgctctatgtctac
caacgcaaggacgtcgacggcagcccgtgggtacgcgtcggtgccgccaccgatgggcgc
agcgacggttggttgccggcgtcacacgtcagcgactggaaacagagcctggtgctcaag
ttcaccgaacgttcgggccgggcgcccgtgatgttcctgcgccaatccggcgaagtagag
aagttgttggccgacccagccgccgccaaaggcgtgctggccaaggcgcagaaaaacagc
gaagacaacagccagatactggccctggaaccgacggccagcgcggtgccgcagaatcag
ttctacctgttgccgatcttcgattccaaagagacctttgacgaaaacggccagccggtg
cagttgctcaatgtggcctccatcgaccccggcagcagcgcagccgccaagccctcgacg
ccggtgatcaaggccaacgccgatgccttccgtaccgccgtggtgttggtggtcgacacc
accgtgtcgatgcagccctacatcgaccagattcgcgacgtggtgcacgaactgcaaacc
cgcatcgccgagcgtggcgagttggacagtgtcagtttcggcatggtgggctttcgcagc
agtatcaagaaaaccccaggcctggagtacgtggccaagaccctgatcagcctcgaccag
ggccgcgacccgcaacgcttcctcgacatggcgcgccaggtcaaggcgtccacggtgtcc
agccactcgttcaacgaagacgcgttcgccggggtgatgcaggcggtggatggcatggat
tggtccggctacggcgggcgcattatcctgctggttaccgacgctggcgcgctgcgcaag
aacgacccgtttgccgccacccagatgaacgaagccgaagtgcgccaggcggcgctgggc
aagcagatcaagatctacgccctgcacctgcgcaccgacgccggcaagaaaacccatgcc
ggtgccgagagccagtaccgcatccttaccgccgacgccaacccgcagatcggcgacctc
tacacgccggtgccgggtggcgacgtgcgtaaattgggcgagcgtgtggacgaaatcggc
acggtgttcgccaaccttgttcatcaggtacgcagcaatacgccgcagccagtgccgttg
ttgagttccgcgccaaccttggcggataaatccgcagccgtcggctacgccatgcacatg
gatttcctcggtcgcaaagccgcgagccaggcgccgcaactggtcagcgcctggaccgcc
gaccgcgacctgaccaacccggcactgccggcgttccaggtctgcgtgatgctgaccaaa
ttgcagctcaacgacctgcaacagtcgttgaaactgatcgtcgacgcggcgcgcaagacc
cagacttcgcccaaggacttcttccaggaaatcgccagcgcctctgcctacatgagccgc
gacccgcaggccctgcgcaagggcggcaacctggccgacggcggcattcttggcgaatac
ctggaaggcctgccgtaccgcagcaagtcgctgaacatgacccaggacttgtggttgtcg
ttgagcgtggccgagcaggaagactttatcgacgagctggattcgaagatccgcctctat
gaaaccttccacaatgacgtggccaactgggtccgtttcggcgatgccgagccgggcgac
gcgttgtaccgcgtgccgctgtcgacgttgccgtga

DBGET integrated database retrieval system