KEGG   Pelosinus fermentans: JBW_00035Help
Entry
JBW_00035         CDS       T03813                                 

Definition
(GenBank) Hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pft  Pelosinus fermentans
Pathway
pft00010  Glycolysis / Gluconeogenesis
pft00051  Fructose and mannose metabolism
pft00052  Galactose metabolism
pft00500  Starch and sucrose metabolism
pft00520  Amino sugar and nucleotide sugar metabolism
pft00521  Streptomycin biosynthesis
pft01100  Metabolic pathways
pft01110  Biosynthesis of secondary metabolites
pft01120  Microbial metabolism in diverse environments
pft01130  Biosynthesis of antibiotics
pft01200  Carbon metabolism
Module
pft_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pft_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JBW_00035
   00051 Fructose and mannose metabolism
    JBW_00035
   00052 Galactose metabolism
    JBW_00035
   00500 Starch and sucrose metabolism
    JBW_00035
   00520 Amino sugar and nucleotide sugar metabolism
    JBW_00035
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    JBW_00035
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    JBW_00035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pft04131]
    JBW_00035
Enzymes [BR:pft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     JBW_00035
Membrane trafficking [BR:pft04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    JBW_00035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: AJQ25389
UniProt: I9NWH3
LinkDB All DBs
Position
complement(46788..48113)
Genome map
AA seq 441 aa AA seqDB search
MSKLLTQLHELVTQLTISPEQIGAIATKFQQAMQNGLIGAPSSLKMLPSYLSKPSRKEIG
TFLALDFGGTNVRVLLTELLGEGQYRIHARAGKPLKQGEMQYNYISKQSTADHLFDFIAK
QIAPLVKPDQIYPLGHTFSFPTDQKGLNTGTLIHWTKEIETTGVEGKDITTLLRSALDRQ
NLRNVIPKAIINDTVGTLLASAYEDPFTDIGSICGTGHNTAYIEPCAPDSKSPMIINLES
GNFDQLPFTAYDALLDQQSEKPGEQRLEKMVSGHYIGELVRIITCSLFDDGLLAGSTSTR
KILTTPYILHGAYISLLLEDGSEENEQIAHFLESKLGITNSTLEDRRTLKKIASLVSIRS
ARLVAATYIGILHHIDPDCSQNHTIAIDGSLYEKTPNYAKTIQMTLDEGLGTKKKITSTL
TKDGSGIGAAIATAIAIHTES
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttgttaactcaactacatgaactagtcacacaactcaccatttcccctgaa
caaattggtgccatcgccactaaatttcaacaagctatgcaaaatggcctaatcggagca
cctagttcattaaaaatgttgccctcttatttaagcaaaccgtcccgaaaagaaatagga
acatttctggctttagattttggcggaaccaatgtaagagtcctgttaacggaattgttg
ggagaaggacagtatagaatacatgctcgggcaggaaagccccttaaacagggagaaatg
caatacaattatatatctaaacaatctactgccgatcacttatttgattttattgcaaag
caaattgcccctcttgtaaaacccgatcagatatatcccctaggtcatacgttttccttc
cccactgaccaaaaaggtcttaatacaggcacattaattcattggacaaaagaaattgaa
acaactggtgtggaaggtaaggacattacaaccttgctacgatcagccttagacagacag
aatcttcgtaatgtgatacctaaagccatcatcaatgatactgtcggtaccttacttgcc
tcagcctatgaagatccctttacagatattggctctatttgcggtactggccacaacaca
gcttatattgaaccttgtgcgccggatagcaaaagcccaatgattatcaacctagaatca
ggtaattttgatcaattaccctttacagcttatgatgccctattagaccaacaaagtgag
aaacccggcgagcaacgattagaaaaaatggtctctggtcactatattggtgagttagtg
cgcattataacctgtagtttatttgacgatggattattggcaggaagcacctctacaaga
aaaatactaaccactccttatatactacatggtgcttatatttcgcttttattggaagat
ggcagtgaggagaatgaacagatcgcccactttcttgagagcaagctaggtattacaaac
tctacgcttgaggatcgccgaaccttaaaaaagattgcctcccttgtatccattcgctct
gcccgcttggtggcggctacttatatcggaattctgcatcatattgatccggattgttct
caaaatcataccattgccatcgacggctcactatacgaaaaaactcctaactacgctaaa
accattcagatgacgttggatgaaggacttggaactaagaagaaaattaccagcaccctt
acaaaagatggctcaggtattggtgctgccatcgctaccgccattgcgatacatacagaa
agttaa

DBGET integrated database retrieval system