KEGG   Pelosinus fermentans: JBW_00480Help
Entry
JBW_00480         CDS       T03813                                 

Definition
(GenBank) DegS sensor signal transduction histidine kinase
  KO
K07777  two-component system, NarL family, sensor histidine kinase DegS [EC:2.7.13.3]
Organism
pft  Pelosinus fermentans
Pathway
pft02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pft00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JBW_00480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pft01001]
    JBW_00480
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pft02022]
    JBW_00480
Enzymes [BR:pft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     JBW_00480
Protein kinases [BR:pft01001]
 Histidine kinases
  NarL family
   JBW_00480
Two-component system [BR:pft02022]
 NarL family
  DegS-DegU (multicellular behavior control)
   JBW_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegS HisKA_3 HATPase_c HATPase_c_2 YnfE AAA_13 Organ_specific DUF1664 Macoilin
Motif
Other DBs
NCBI-ProteinID: AJQ25832
UniProt: I9NNC5
LinkDB All DBs
Position
622941..624071
Genome map
AA seq 376 aa AA seqDB search
MKNIDISDLDRIVKTTIDAVEQGKTQIFDIYEAARNEVENIKKDVERTKQETVAIIFTVD
DLEKKERRSRIKLMEVSRNFSVYSEDDIKAVYEDARNLQVELAVARAQEQSLRQQRDELE
LRLRSLKDTVSKAEGLTTQVGAVLGYLGDEMGNVVVKIESLQQSQVFGAKIIKAQEEERR
RVSREIHDGPAQAMANIVFRAEVCERLIDIDVLRAKKELTDLRAQVRLCLKETRKIIFDL
RPMTLDDLGLVPTVKRFLDTVKERSGMISDIRILGEERRLDSYVEIGVFRIFQEAITNIE
KHAQAQTISIAMEFRRDTFLATIADDGKGFNTADNFGNESFGLLGMRERIHLLNGELTIK
SEIGVGTKVIIKVVFK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattgatattagtgatcttgataggattgtcaaaactacaattgatgcggta
gagcaaggaaagacacaaatttttgatatttatgaggcggctcgtaatgaagttgaaaat
ataaaaaaggatgtagaacgtacaaagcaggagacagttgctatcatttttacagtggat
gatttagaaaagaaagagcggcgttctaggatcaagttaatggaagtcagccgtaatttc
agcgtatattcagaagatgatattaaagcagtatatgaagatgcgagaaacttacaagtt
gaattagcggtagctcgcgctcaggaacaaagtttacgtcagcagcgtgatgagttagag
cttcgtttacgctctttaaaagatacggtgtctaaggcagaaggattaacaacacaggta
ggagcagttctagggtatttaggcgacgaaatgggcaatgtagtagtgaaaattgaatcc
ttgcagcagagtcaagtgtttggtgccaaaattatcaaagcccaggaagaagaacgccgt
agagtgtcacgagaaattcatgatggaccagctcaagctatggcaaatattgtgtttcga
gcggaagtttgtgagcgattgattgatattgatgtgctgcgtgcaaaaaaagaactgaca
gatcttcgtgcacaagtacgtctttgcttgaaagaaacgagaaaaattatttttgattta
cgtccaatgacattagatgatttgggtttagtacctacggtgaagcggtttttagatacg
gtaaaagagcgcagcggtatgatttccgatattaggatattaggtgaagaacggcgctta
gattcctatgtggaaattggtgtatttagaatttttcaagaagcaattacaaatattgag
aaacatgcccaggctcagacgatatccattgctatggaatttcgcagggataccttctta
gcaaccattgctgatgatggtaagggttttaatacagcagataattttggtaacgaaagt
tttggtttactggggatgcgggagcgaattcatctgttaaatggtgagctaacaataaag
tccgaaattggggtaggcacaaaagtcattataaaagtagtatttaaataa

DBGET integrated database retrieval system