KEGG   Pelosinus fermentans: JBW_01418Help
Entry
JBW_01418         CDS       T03813                                 

Definition
(GenBank) Inosose dehydratase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
pft  Pelosinus fermentans
Pathway
pft00562  Inositol phosphate metabolism
pft01100  Metabolic pathways
pft01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    JBW_01418
Enzymes [BR:pft01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     JBW_01418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 UxuA AP_endonuc_2_N DUF1059
Motif
Other DBs
NCBI-ProteinID: AJQ26770
UniProt: I8U3E0
LinkDB All DBs
Position
1684640..1685536
Genome map
AA seq 298 aa AA seqDB search
MFNKEKVKLGIAPIAWTNDDMPDLGKENTFEQCISEMALAGFTGSEVGCKYPKDVNVLKK
ALNLRGLQIASAWFSAFLTTKPYEETEREFIRHRDFLHAMGAKVVVVSEQGHSIQGKLDI
PIFTGKYNLNDKEWQNFAEGLNKLGALAKEKDMKLVYHHHMGTVVQTTEEIDRLMNMTDE
NLVYLLFDSGHLAYSGEDFISILKKYVNRIKHVHLKDVRPEMQEKVRKENLSFLQGVRAG
AFTVPGDGCIDFGPIFTILSENKYEGWLLVEAEQDPAQANAFEYAQKARNYIKEKIGF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacaaggaaaaagtaaaattaggaatcgcacccatcgcttggacgaatgatgat
atgccggatctggggaaagaaaatacttttgaacaatgtataagcgaaatggctcttgct
ggttttactggttcagaagtaggttgtaaatatcccaaagatgtaaatgttttaaaaaag
gcccttaatttaagaggattacaaatagcaagtgcttggtttagtgcctttttgacaaca
aagccatatgaagaaacagaaagagaattcattcggcacagagattttctacatgctatg
ggggctaaagtcgttgtagtatcagaacaaggccatagtatacaaggaaagctggatatt
ccgatattcacaggaaaatataatttaaatgataaagagtggcagaactttgcagagggc
ttaaacaaattaggtgccttagcaaaagaaaaggatatgaaattggtttatcatcatcat
atgggaactgtagttcagactacggaagaaatagaccgacttatgaatatgacagatgaa
aacttggtgtatttattatttgactcaggacatctagcgtattcaggggaagattttatt
tcgatattaaaaaaatatgttaacagaattaaacatgttcatttaaaagatgtgcgtcca
gaaatgcaagagaaagttagaaaagaaaacttaagtttccttcaaggggttagagcaggt
gcatttacagtgccaggagatggatgcatcgattttgggccaatctttacgattttgtct
gaaaataagtatgaaggatggctgttagtagaggcagagcaggatccggcacaagcaaat
gcttttgaatatgcgcaaaaggctagaaactatatcaaagaaaaaatagggttttaa

DBGET integrated database retrieval system