KEGG   Pelosinus fermentans: JBW_02237Help
Entry
JBW_02237         CDS       T03813                                 

Definition
(GenBank) Late competence development protein ComFB
  KO
K02241  competence protein ComFB
Organism
pft  Pelosinus fermentans
Brite
KEGG Orthology (KO) [BR:pft00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pft02044]
    JBW_02237
Secretion system [BR:pft02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   JBW_02237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComFB
Motif
Other DBs
NCBI-ProteinID: AJQ27583
UniProt: I8TZQ0
LinkDB All DBs
Position
2522955..2523131
Genome map
AA seq 58 aa AA seqDB search
MEIKNYMEILVMEKLDIVIKANRTTCNCKRCRYDIAALALNSLPTRYVATSSGQHILK
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaaaattatatggaaatattagtaatggaaaaactggatatcgttataaag
gccaatcgtacaacgtgtaattgtaagcgctgtcgatatgacatcgctgcattagcccta
aattctctgcctacacgttatgttgcaacatcttcaggacaacatattctaaaatag

DBGET integrated database retrieval system