KEGG   Pelosinus fermentans: JBW_02830Help
Entry
JBW_02830         CDS       T03813                                 

Definition
(GenBank) Thioredoxin-disulfide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pft  Pelosinus fermentans
Brite
KEGG Orthology (KO) [BR:pft00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JBW_02830
Enzymes [BR:pft01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JBW_02830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored Pyr_redox K_oxygenase DAO NAD_binding_8 Thi4 FMO-like NAD_binding_9 Lycopene_cycl NAD_binding_7 FAD_binding_3 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AJQ28174
UniProt: I9DL68
LinkDB All DBs
Position
complement(3175178..3176089)
Genome map
AA seq 303 aa AA seqDB search
MYDLIIIGGGPAGLTAAVYAARKKMNTLLLTKEFGGQLMWTKEIENYMGYQFISGPELMG
KFEEQVKRFAVAIQYEEVNGLIVNQDGTFLVKTEETEYQSKTVILATGKRPRGLDIPGEK
EFTGRGVSYCATCDGPFFDNKAVAVIGGGNSAVQAALELSKIAHTVYLVVRNDHYIADPI
ILEKMKVATNIIEKIGYESEGIYGNEVVEKITIREITTGELQDLAIDGVFVEIGLEPNSE
YVEDIVRMNKRKELMVDCRSRTNIPGVYAAGDITDGPDKQIVIAAGDGAKAALMAYDYLL
HKE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatttgattattataggcggtggacccgccggactgactgccgcagtgtatgca
gctcgcaaaaaaatgaatacgctactactgacaaaagaatttggcggacaactcatgtgg
acaaaagaaatagaaaattatatgggttatcaatttattagtggtccagaactaatggga
aaatttgaagaacaggtgaaacgttttgccgttgccattcaatatgaagaagtaaatggc
ttaatagtgaatcaagatggtacatttttggttaagacagaagagacggaatatcaaagt
aaaactgtgatcctagccacaggtaaaaggcctagggggctagacataccaggagagaaa
gagttcactgggcggggggttagctattgtgccacttgtgatggtcctttttttgacaat
aaagcggtagctgttatagggggtggcaactcagcagttcaagcagctctcgaacttagc
aaaattgcacataccgtatacttagtggtacgaaatgatcattacattgctgatcctatt
attcttgaaaaaatgaaagttgctaccaatattattgaaaagatcggttatgaatccgaa
ggaatttatggtaatgaggtagtggaaaagattacgatccgtgagattacgacaggggaa
cttcaagatctggccatcgatggggtttttgtagaaattggcttagaacccaattctgag
tatgtagaagatatcgttaggatgaataagagaaaagaactgatggtcgattgccgttct
agaaccaatattccaggagtgtatgcagctggagatattacagatggtcctgataaacaa
atcgtaatcgccgcaggagatggtgctaaagctgctttgatggcttatgattatttgttg
cacaaggaataa

DBGET integrated database retrieval system