KEGG   Pyrococcus furiosus DSM 3638: PF0209Help
Entry
PF0209            CDS       T00075                                 

Definition
(GenBank) ribosomal protein s6 modification protein
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00300  Lysine biosynthesis
pfu01100  Metabolic pathways
pfu01210  2-Oxocarboxylic acid metabolism
pfu01230  Biosynthesis of amino acids
Module
pfu_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PF0209
Enzymes [BR:pfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     PF0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp ATP-grasp_3 GSH-S_ATP Dala_Dala_lig_C CPSase_L_D2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AAL80333
UniProt: Q8U482
LinkDB All DBs
Position
225439..226260
Genome map
AA seq 273 aa AA seqDB search
MKIGITFTILRKEELMFKNKAKEFGEVVMINDREVVFPGRYDVDVVIIRDISHFKALYIS
KLFEEAGVPVVNPHWVIYEAGDKLLATLRLEKKVPVPRWAVAFDKDSAIRATKELGYPVV
VKPVFGSWGRLVAKIQDEFSAEGIFEHREWMGNPLNKIYYIQKYVEKPGRDIRAIVIGGE
FITAIYRYSDHWITNAARGAKAEPCNDEEVMDIAVKAWEAFGEGALAIDIFESPEGLLVN
EVNPIMEFKLAYETTNADIPGKLVEYAVNYAKS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagggataacgtttacaatccttagaaaagaggagcttatgtttaagaataag
gctaaagaatttggggaagttgtaatgataaatgatagagaagttgtcttcccaggtaga
tacgatgttgatgttgttataataagagatataagccatttcaaagctctctatatttca
aagttatttgaagaagcaggtgttccagttgttaatccgcactgggtaatttatgaggct
ggagataagttgctggcaaccttaaggttggaaaagaaggttccagttcccaggtgggcc
gtggcttttgataaagactccgcaataagggcaacaaaagagcttggatatcctgttgtt
gttaaaccagtctttggtagctggggaagattagtggcgaaaattcaagatgaattctct
gcagaaggaatatttgagcatagggagtggatggggaatcctctcaacaagatatactac
atccagaaatatgtcgaaaaacctggaagggacattagagcaattgtaataggaggagag
tttataaccgctatatacaggtattctgatcactggattacaaatgctgcaagaggagca
aaggcagaaccctgtaatgatgaagaagttatggatatagcagttaaagcctgggaagct
tttggtgaaggggctttggcgatagacatatttgaaagtcctgagggattgttggtgaat
gaagttaacccaatcatggaatttaagctagcttacgaaacgacgaatgctgatattcct
gggaagttagttgagtatgcagttaactatgcaaagagttag

DBGET integrated database retrieval system