KEGG   Pyrococcus furiosus DSM 3638: PF0991Help
Entry
PF0991            CDS       T00075                                 

Definition
(GenBank) possible threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00260  Glycine, serine and threonine metabolism
pfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PF0991
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     PF0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AAL81115
UniProt: Q8U259
LinkDB All DBs
Position
complement(946117..947163)
Genome map
AA seq 348 aa AA seqDB search
MSEKMVAIMKTKPEYGAELVEVDVPKPGPGEVLIKILATSICGTDLHIYEWNEWAQTRIR
PPQIMGHEVAGEVVEVGPGVEGIEVGDYVSVETHIVCGKCYACKRGQYHVCQNTKIFGVD
TDGVFAEYAVVPAQNVWKNPKNIPPEYATLQEPLGNAVDTVLAGPIAGKSVLITGAGPLG
LLGIAVAKASGAYPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVMDITDGNGVDVF
LEFSGAPKALEQGLQAVTPAGRVSLLGLFPGKVSIDFNNLIIFKALTVYGITGRHLWETW
YTVSRLLQSGKLNIDPIITHKYKGFDKYEEAFELMRAGKTGKVVFMLK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaagatggttgctatcatgaagacaaaaccagagtacggtgcagagttagtt
gaagtagatgtaccaaaacctgggccaggggaagtcctaataaaaattcttgcaacaagc
atatgtggaactgacctgcacatttatgaatggaatgaatgggctcagacaagaattagg
ccacctcagataatggggcatgaggttgcaggagaggttgtggaagttggtccaggtgta
gagggaattgaagttggtgattacgtttctgttgagactcacatagtctgtggaaagtgt
tacgcatgtaaaagagggcaatatcacgtatgtcaaaacacaaagatatttggagtagat
actgacggtgtttttgccgaatatgcagtagttccagcacaaaacgtctggaagaatcca
aagaacatacctcccgaatatgctactctacaagagccattgggaaatgctgtggataca
gtacttgctggcccaattgccggaaagagcgttctcattactggagcaggtcccctggga
cttcttggaatagcagtggcaaaggcatccggagcctatcctgtgatagtttctgagcca
agtgaatttagaagaaacttggcaaagaaggtgggtgcagactacgtaataaatccattt
gaagaagatgttgtaaaggaggtaatggacataaccgacggaaacggagttgatgtgttc
ttggagttcagcggtgctccaaaggctcttgagcaaggactccaggcagtaactccagct
ggaagggtttctcttctcggactattcccaggaaaagtgagcatagactttaacaacctt
ataatattcaaggcattgacagtttacggaatcactgggagacacctttgggaaacttgg
tatacagtctctagactgctccaaagtggaaaattaaatatagacccaataataactcac
aagtacaagggatttgacaagtatgaagaagcctttgagctaatgagggctggcaaaact
ggcaaagttgttttcatgcttaaatga

DBGET integrated database retrieval system