KEGG   Pyrococcus furiosus DSM 3638: PF1156Help
Entry
PF1156            CDS       T00075                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00630  Glyoxylate and dicarboxylate metabolism
pfu01100  Metabolic pathways
pfu01120  Microbial metabolism in diverse environments
pfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PF1156
Enzymes [BR:pfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PF1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AAL81280
UniProt: Q8U1P9
LinkDB All DBs
Position
complement(1104585..1105847)
Genome map
AA seq 420 aa AA seqDB search
MKVEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKMPEMA
KRSMAKVFYLEKSGEGYIAKIAYPLTLFEEGSIVQLLSAIAGNIFGMKALKNLRLLDFHP
PYEYLRHFKGPQYGVKGIREFMGVKERPLTATVPKPKMGWSVDEYAEIAYELWSGGIDLL
KDDENFTSFPFNRFEERVKKLYRIRDIVEAETEERKEYLINITGSVDVMEKRAELVANEG
GQYVMIDIIVTGWSALQYMREVTEDLGLAIHAHRAMHAAFTRNPKHGITMYAIAKLARMI
GVDQIHTGTAVGKMAGDYEEVKRINDFLLSKWEHIREVFPVASGGLHPGLMPELIRLFGK
DLVIQAGGGVMGHPDGPRAGAKALRDAIDAALEGVDLEEKAKSSPELKKALDKWGYLKPK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgagtggtatttagacttcgttgacttggactacactccaggtagagatgag
ttaattgtggagtattactttgaaccaaacggggtttctccagaagaagcagccggaagg
atagctagtgaaagctctataggaacgtggacaactctctggaaaatgcccgaaatggct
aagaggagtatggctaaggtattttatctagaaaaaagtggggagggatatattgctaag
attgcatacccattaacgcttttcgaagaaggaagcatagttcaacttttgagtgcgata
gctgggaacatcttcggaatgaaagcgttaaagaatttgaggcttctggacttccatccc
ccttatgagtatctgagacatttcaaagggccacagtatggtgtaaagggaattagagaa
ttcatgggggttaaagagagacctttgactgctaccgttccgaagcctaagatgggatgg
agtgttgatgaatacgcggagatagcatatgaactctggagtggagggatcgatctgtta
aaagacgatgaaaacttcactagctttccattcaacagatttgaagagagagtgaaaaaa
ttatataggattagggatatcgtggaggctgaaactgaggaaagaaaagagtacctaatc
aacattactggatccgttgatgttatggagaaaagagccgaactagtggcgaatgaggga
gggcagtacgttatgatagacataatagtcactggatggagcgcactccagtacatgaga
gaggtaactgaggatcttggattggctatacatgcccacagagccatgcatgccgcgttc
actagaaatcccaagcacgggataacgatgtatgcaatagccaagcttgccagaatgatt
ggcgttgatcaaattcacacggggactgcagttggaaagatggcaggtgattatgaggag
gttaaaaggataaacgacttcctacttagtaaatgggagcacataagagaagttttccca
gtagcaagtgggggacttcaccctggattgatgccagagcttatacgtctcttcgggaaa
gatctcgttattcaagcgggtggaggagttatggggcacccagatgggcccagggctgga
gctaaagccttgagagatgcaatagatgcggctttagaaggggttgatttagaggagaag
gcaaagtcgagtccagagctgaaaaaggcattagacaagtggggctacctaaagcctaaa
tga

DBGET integrated database retrieval system