KEGG   Pyrococcus furiosus DSM 3638: PF1203Help
Entry
PF1203            CDS       T00075                                 

Definition
(GenBank) formaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu00030  Pentose phosphate pathway
pfu01100  Metabolic pathways
pfu01120  Microbial metabolism in diverse environments
pfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PF1203
Enzymes [BR:pfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PF1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AAL81327
UniProt: Q8U1K3
LinkDB All DBs
Structure
PDB: 

Position
1143520..1145403
Genome map
AA seq 627 aa AA seqDB search
MNVKMVDSMYGWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEARGVEPL
SPENKLIFAAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVE
GKAKKPVYIYIEDDNVSILSAEGLWGKTTFETERELKEIHGKNVGVLTIGPAGENLVKYA
VVISQEGRAAGRPGMGAVMGSKKLKAVVIRGTKEIPVADKEELKKLSQEAYNEILNSPGY
PFWKRQGTMAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTMEGMKVQQRGCPYCNMPCG
NVVLDAEGQESELDYENVALLGSNLGIGKLNEVSVLNRIADEMGMDTISLGVSIAHVMEA
VERGILKEGPTFGDFKGAKQLALDIAYRKGELGNLAAEGVKAMAEKLGTHDFAMHVKGLE
VSGYNCYIYPAMALAYGTSAIGAHHKEAWVIAWEIGTAPIEGEKAEKVEYKISYDPIKAQ
KVVELQRLRGGLFEMLTACRLPWVEVGLSLDYYPKLLKAITGVTYTWDDLYKAADRVYSL
IRAYWVREFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLDEKKYDELLSEYYRIRGWDER
GIPKKETLKELDLDFVIPELEKVTNLE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaagatggtggattctatgtatggatggtggggtaggattctaagggtaaac
ctaacaactggagaagttaaggttcaggaataccccgaagaagttgccaagaaatttatt
ggaggtagaggattagccgcctggattctttggaatgaagctagaggtgttgagcccctt
agtccagaaaacaagttaatctttgctgctggtcccttcaatggccttccaaccccgagc
ggtggaaagcttgtagttgcggctaagagtcctctaactggaggttatggtgacggcaac
ctaggaacaatggcttctgttcacttgagaagggcaggttatgatgctctcgttgttgaa
ggtaaggcaaagaagcccgtctacatttatatcgaagatgacaacgttagcatccttagt
gctgaaggtctatggggtaagacaacattcgagaccgagagagaattaaaggaaatccat
ggcaagaacgtcggcgttttaaccatcggaccagccggagaaaatttagttaaatatgct
gttgttatctcccaggagggaagagctgctggaagacctggaatgggtgctgtaatggga
agcaagaagttaaaggccgtagtaataaggggaaccaaggagataccagttgcagacaag
gaagagttaaagaagctcagccaggaggcatataatgaaattctaaactctccagggtat
ccattctggaagagacaggggaccatggcagctgtagagtggtgtaatactaactatgcc
ctcccaacaaggaacttcagcgatggctacttcgaattcgctcgttcaatagatggttac
acaatggaggggatgaaggtacagcagaggggctgtccctactgtaacatgccgtgtgga
aatgtagtgcttgatgcagagggccaagagagtgagcttgactatgaaaatgtagccttg
ctgggttcaaaccttggaatagggaagcttaacgaggtttcagttctcaacaggatagct
gacgagatgggtatggacacgataagcctcggtgtttcaatagcccacgtaatggaggct
gtggagagaggaatcctcaaggaagggccaacatttggagacttcaagggagctaagcaa
ttggccttggatatagcttacagaaaaggagagctcggcaacttagctgcagagggagtt
aaggctatggccgagaagcttggaactcatgatttcgcaatgcacgttaagggattagag
gttagtggttacaactgttacatctacccagcaatggcattagcttatggaacgagcgca
atcggtgcacaccacaaggaggcatgggttattgcatgggaaatcggtactgccccaatt
gaaggagagaaggccgagaaggtggagtacaagataagttacgatccaataaaggcccag
aaagttgttgagttgcagaggttgagaggtgggctcttcgagatgcttacggcatgtagg
ctaccatgggttgaggttggcctaagcctagactactatccaaagctcctcaaggcaata
actggagtcacctacacctgggatgacctttacaaggcagctgacagggtttattccctc
ataagagcttattgggtgagagaattcaacggcaagtgggatagaaagatggattaccca
ccaaagagatggttcacagagggactgaagagtggcccgcacaagggagagcacctcgat
gagaagaagtacgatgagttgctctcagagtactacagaataaggggatgggacgagaga
ggaattccaaagaaggaaactttgaaagagcttgacctcgacttcgtaattcctgagctg
gagaaggttacaaaccttgagtga

DBGET integrated database retrieval system