KEGG   Pyrococcus furiosus DSM 3638: PF1635Help
Entry
PF1635            CDS       T00075                                 

Definition
(GenBank) DNA ligase (lig)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
pfu03030  DNA replication
pfu03410  Base excision repair
pfu03420  Nucleotide excision repair
pfu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pfu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PF1635
   03410 Base excision repair
    PF1635
   03420 Nucleotide excision repair
    PF1635
   03430 Mismatch repair
    PF1635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pfu03032]
    PF1635
   03400 DNA repair and recombination proteins [BR:pfu03400]
    PF1635
Enzymes [BR:pfu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PF1635
    6.5.1.6  DNA ligase (ATP or NAD+)
     PF1635
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PF1635
DNA replication proteins [BR:pfu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PF1635
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PF1635
DNA repair and recombination proteins [BR:pfu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PF1635
   NER (nucleotide excision repair)
    Other NER factors
     PF1635
   MMR (mismatch exicision repair)
    Other MMR factors
     PF1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AAL81759
UniProt: P56709
LinkDB All DBs
Structure
PDB: 

Position
1525737..1527422
Genome map
AA seq 561 aa AA seqDB search
MRYLELAQLYQKLEKTTMKLIKTRLVADFLKKVPDDHLEFIPYLILGEVFPEWDERELGV
GEKLLIKAVAMATGIDAKEIEESVKDTGDLGESIALAVKKKKQKSFFSQPLTIKRVYQTL
VKVAETTGEGSQDKKVKYLADLFMDAEPLEAKYLARTILGTMRTGVAEGLLRDAIAMAFH
VKVELVERAYMLTSDFGYVAKIAKLEGNEGLAKVQVQLGKPIKPMLAQQAASIRDALLEM
GGEAEFEIKYDGARVQVHKDGSKIIVYSRRLENVTRAIPEIVEALKEAIIPEKAIVEGEL
VAIGENGRPLPFQYVLRRFRRKHNIEEMMEKIPLELNLFDVLYVDGQSLIDTKFIDRRRT
LEEIIKQNEKIKVAENLITKKVEEAEAFYKRALEMGHEGLMAKRLDAVYEPGNRGKKWLK
IKPTMENLDLVIIGAEWGEGRRAHLFGSFILGAYDPETGEFLEVGKVGSGFTDDDLVEFT
KMLKPLIIKEEGKRVWLQPKVVIEVTYQEIQKSPKYRSGFALRFPRFVALRDDKGPEDAD
TIERIAQLYELQEKMKGKVES
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatctagagcttgctcaactttatcaaaagttagaaaagacaactatgaaactt
ataaagactagacttgtcgccgacttcctgaaaaaagtaccagatgatcatctggagttc
attccctatctaattcttggagaagtttttccagagtgggatgaaagggagctgggtgtg
ggagaaaagctgttaattaaagctgtagcaatggccactggaattgacgcaaaagaaatc
gaagagtctgtaaaagatactggagaccttggagagagcatagccttagctgtaaagaaa
aagaagcagaagagcttcttctctcagcccctcacaataaagagggtatatcaaaccctt
gtaaaggttgcagaaacaacgggggagggaagccaagataaaaaagtaaagtatctagct
gatttgttcatggacgcagaacctttagaagctaagtatcttgctcgtacaatcttagga
acaatgagaacaggagttgcagaaggattgcttagagatgcaatagcaatggcattccac
gtaaaggtagagcttgttgagagagcttacatgctaacgagtgatttcggatatgtagct
aaaatagcaaagcttgaaggaaatgaagggctagcaaaagttcaagttcaactcggaaag
ccaataaagccaatgcttgcccagcaagctgctagcataagagatgcacttctcgagatg
ggtggagaggcagagttcgagattaaatacgatggagcaagggtgcaggtgcacaaggat
ggctcaaaaattatagtctattctagaagactggagaacgtcaccagagcgattccagaa
attgttgaggctctaaaagaggcaataatacctgaaaaggcaatagtggaaggagaactt
gtggcaattggagaaaacggaagaccattgcccttccaatatgtgcttagaaggtttagg
agaaagcataacatagaagaaatgatggaaaagatacctctcgagctcaacttattcgac
gttctctacgtagatggacaaagcttgattgacactaagttcattgatagaagaagaaca
cttgaagaaataataaagcagaatgaaaagataaaggtagcagaaaacctaataacaaag
aaagtcgaggaagcagaggcattttacaagagagcactcgaaatggggcacgagggattg
atggccaagaggttagatgcagtctacgaaccaggtaacagaggaaagaagtggttgaag
ataaagcccacaatggagaacttagatttagtaatcataggagcagaatggggagaggga
agaagagcccatctctttggttcattcatcctgggagcatatgatccagaaacaggagaa
ttcctagaggtaggaaaagtgggaagtggattcacagatgatgacttagttgagtttacg
aagatgctaaagccccttattataaaagaggaaggaaagagagtctggctccagcccaaa
gttgttattgaagtgacatatcaagaaattcagaagagtccaaaatacagaagtggattt
gcattaaggttcccaaggttcgttgcacttagagatgataaaggaccagaagatgcagat
acaatagagagaatcgcacaactttacgagttgcaagaaaagatgaaaggaaaagtggaa
agctaa

DBGET integrated database retrieval system