KEGG   Prevotella fusca: ADJ77_06000Help
Entry
ADJ77_06000       CDS       T04032                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pfus  Prevotella fusca
Pathway
pfus00500  Starch and sucrose metabolism
pfus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ADJ77_06000
Enzymes [BR:pfus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ADJ77_06000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C zf-UBP_var
Motif
Other DBs
NCBI-ProteinID: AKU69348
UniProt: A0A0K1NKC5
LinkDB All DBs
Position
1:complement(1453085..1455223)
Genome map
AA seq 712 aa AA seqDB search
MKKINIALIGLLMGMAGVVNAQTVKSPNGNVAVTFSLTGNGVPTYEMTYKGKAVVKPSHL
GLELAKNKHASKGMEETSLLEGFEKTGTKTTSFDETWKPVWGETSTIRNHYNELEVDLNQ
PASKRNIVIRFRVYDDGMGLRYEFPQQAELNYFVIKEEHTQFAMAGDHTAWWLPGDYDTQ
EQETQESKLSEIRKRFREAVNWSNSSVSVFSETGVQTSLQMKSADGLYINIHEAACADYA
TMHLNLDDKTMTFESWLTPDATGLKGFMQTPCETPWRTVMVSDDARDMLANNLILNLNEP
CKIEDTSWIHPTKYCGVWWEMIAGGKSWAYTDEFSSVKLGQTDYAHAKPNGRHSANTANV
KKYIDFAAANGLDQVLVEGWNIGWEDWFGHWKQDVFDFVTPYPDFDLKGLNEYAHSKGVK
LMMHHETSSSTQNYERHMEDAFKLMNKYGYDAVKTGYVGDIIPRGDHHYSQSMNNHYMRV
IKEAAKHHIMVNGHEATRPTGLCRTWPNLVGNESARGTEYEAFGGSHPNHTVILPFTRLQ
GGPMDYTPGILETQLSTWCDNKSYVHTTLVGQLALYVTMYSPLQMAADLPENYQKYNDAF
QFIKDVACDWDDSRYLEAEPARYVTVARKAKGTDNWFVGGKTGLAAHLSVLKLDFLDKGR
KYEATIYADAKDADYEKNPKAYTVTRRMVKKGDVLKLQQVRGGGFAISLKAL
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcaatatcgccctcattgggctactgatgggaatggctggcgttgtcaat
gcccagactgtaaagtctccgaacggcaatgtcgctgtgaccttctcgttgacagggaac
ggagtacctacctatgagatgacttacaaaggtaaggctgtggtaaagccatcacacttg
ggattggaattggctaagaacaagcatgccagcaagggcatggaagaaaccagtcttttg
gaaggttttgagaagaccggtaccaagacgacttctttcgatgagacatggaagcctgta
tggggcgagacttctaccatccgtaatcattataatgagttggaggtagaccttaaccaa
cctgcaagcaagcgtaacatcgttatccgtttccgcgtctatgacgatggaatgggactt
cgttacgagtttccgcagcaggcggaactgaattactttgttatcaaggaagagcataca
cagtttgctatggcaggcgaccatacggcttggtggcttcccggtgactatgacacgcag
gagcaggagacacaggagtcaaaactttcagagattcgcaagcgattccgtgaggctgtg
aactggagcaactcatcagtttctgttttctcagaaacgggtgtccagacttctttacag
atgaagtctgccgacggtctgtatatcaatatccacgaagctgcatgtgctgactatgca
accatgcaccttaatcttgatgacaagacaatgaccttcgagtcatggcttactcctgat
gctactggtttgaaaggatttatgcagactccgtgcgaaactccatggcgtacggtgatg
gtgagcgacgatgcacgtgacatgcttgccaacaatctcatcctcaatctcaacgaacct
tgtaagattgaagacacttcatggattcatccgaccaagtactgtggtgtatggtgggag
atgattgccggtggaaagtcctgggcttatacggatgaattcagctctgtgaaactcggt
cagactgattatgcacatgcaaagccaaacggtcgtcactctgcaaataccgctaatgtg
aagaagtatattgactttgctgctgccaacggtttggatcaggtgctggttgaaggctgg
aatatcggttgggaggactggttcggacattggaagcaggatgtattcgactttgttact
ccttatcctgactttgacctcaaggggctgaatgagtatgctcactccaaaggggtgaaa
ctgatgatgcaccatgagacctcttcaagcacacagaactatgaacgtcacatggaagat
gcattcaaactgatgaataaatatggatatgatgctgtgaagacgggctacgttggcgat
attatcccacgtggcgaccaccactattcacagtcaatgaacaaccattacatgcgtgtt
atcaaggaagctgccaagcatcatatcatggtgaacgggcatgaggcaacccgcccgaca
ggtctttgccgtacatggcctaacctcgtcggcaacgaatcagcacgtggaactgaatat
gaggcgttcggcggaagtcatcctaaccacactgttatcctcccgttcacccgtctgcag
ggcggtccgatggactataccccgggtattcttgagacacagctctctacatggtgcgac
aacaagagctatgtacacactaccctcgtcggtcagcttgccctttacgtaaccatgtat
agcccgcttcagatggcagctgacctgcctgagaactatcagaagtataatgatgctttc
cagttcatcaaggatgtagcctgtgactgggatgacagtcgttaccttgaggctgagccg
gcacgttacgttaccgttgcccgcaaggcaaaaggcactgataactggtttgtgggtgga
aagacaggactcgcagcacacctgagtgtcctcaaactcgacttcctcgacaagggtcgt
aagtatgaggcaaccatctatgcggatgcgaaggatgctgattatgagaagaatccaaag
gcttatactgttaccaggcgtatggtgaaaaagggtgatgtcctcaaacttcagcaggtt
cgtggcggtggttttgccatcagtctgaaagctctttaa

DBGET integrated database retrieval system