KEGG   Pseudomonas fulva: Psefu_1411Help
Entry
Psefu_1411        CDS       T01501                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Psefu_1411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfv02000]
    Psefu_1411
Enzymes [BR:pfv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Psefu_1411
Transporters [BR:pfv02000]
 Other Transporters
  Pores ion channels [TC:1]
   Psefu_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AEF21387
UniProt: F6AFC6
LinkDB All DBs
Position
complement(1533553..1534221)
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSQRILWLLEELGVEYQIKRYERDPQTMLAPPELRAIHPLGKSPVVTDGE
LTLAESGAIIDYLANRYGPHLLPAPESPERLRCTYWLHYAEGSAMSPLLLKLVFDKVESS
PMPFFIKPIARGIAQKVKGAFVTPQLKLHLDYLEGELGKSTWFAGEAFSAADIQMSFPLE
AAAARAGLDASRPRLMAFLERIHARPAYQRALEKGGEYAYAK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccatcacctcaataactcgcgctcgcagcgcatcctctggctgctcgaa
gagctgggcgtcgagtaccagatcaagcgctacgagcgcgacccgcaaaccatgctcgcc
cctcccgagctgcgcgccatacatccgctgggcaagtcgccggtggtcaccgacggcgag
ctgaccctggccgagtccggcgccatcatcgactacctcgccaatcgctacggtccgcac
ctgctacccgcccccgagagccccgagcgcctgcgctgcacctactggctgcactatgcc
gagggctcggccatgtcgccgctgctgctcaagctggtgttcgacaaggtggaaagcagc
ccgatgccgttcttcatcaagccgattgcccgcggcatcgcccagaaggtcaagggcgcc
ttcgtcacgccacagctcaaactgcacctggactatctcgaaggcgagctgggcaagagc
acctggttcgccggcgaagcgttcagcgcggccgacatccagatgagcttcccactggaa
gccgctgccgcgcgtgccggccttgacgccagccgcccacgcctgatggcttttctcgaa
cgcatccacgcccgccccgcctaccagcgcgctctggaaaaaggcggcgagtacgcctac
gcgaagtaa

DBGET integrated database retrieval system