KEGG   Pseudomonas fulva: Psefu_1806
Entry
Psefu_1806        CDS       T01501                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein domain protein
Organism
pfv  Pseudomonas fulva
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 DAO HI0933_like NAD_binding_8 FAD_oxidored FAD_binding_3 Lycopene_cycl Thi4 GIDA
Other DBs
NCBI-ProteinID: AEF21779
UniProt: F6AJJ8
LinkDB
Position
1936500..1937387
AA seq 295 aa
MSYDVIIVGGSYAGLSAGLQLARARRRVLVIDAGVRRNRFASHSHGFLGQDGRAPDEIAA
DGRAELMDYPTVTWQVGEAGEVQRDGEGFVVTLCGGQRVAARRLILAGGVRDELPAIDGL
AERWGRQVFHCPYCHGYELDQGRIGVLAVSPMSIHHALMLPDWGSTTFFLNGVFVPDAEQ
LQQLARRGVVVEPDRVQSISGECVDVNLADGRRVALDGLFVMPRTHQNNPLATQLGCALL
EGPMGLYLQTSETQETSVPGVFACGDAALAAGSVALAVGTGARAGAGVHQSLIFR
NT seq 888 nt   +upstreamnt  +downstreamnt
atgagttatgacgtaatcatcgtcggtggcagctacgccggcttgtccgccggcctgcag
ctggcccgcgcccgacgccgggtgctggtgatcgacgccggcgtgcggcgcaatcgcttc
gccagccattcccacggctttctcggccaagacgggcgtgcccccgacgagatcgctgcc
gatggccgtgccgaactgatggactatccgaccgttacctggcaggtaggcgaggctggc
gaggtgcagcgtgacggcgagggtttcgtcgtgacgctgtgcggcggtcagcgtgtggcc
gcccgtcgcctgatcctggccggcggcgtacgtgacgaactgccggccatcgatgggctg
gccgagcgctggggccgtcaggtgttccactgcccgtattgccatggctacgagctggat
cagggacgcatcggcgtgctggccgtctcgcccatgtcgattcaccacgcgttgatgctg
ccggactggggcagtaccaccttctttctcaacggcgtcttcgtgcctgatgccgagcaa
ctgcagcagctggcgcgccgcggcgtggtggtcgagccggatcgcgtacagtcgatcagt
ggcgagtgcgtggacgtcaatctggccgacggccgccgcgtggcactggacgggttgttc
gtgatgccgcgtacgcaccagaacaatccgctggctacccagctgggttgcgcgctgctg
gaagggccgatgggactgtatctgcaaacctcggaaacccaggaaaccagcgtgccgggc
gtgttcgcctgcggcgacgcggcactggctgccggttccgtagcgctcgctgtcggcacg
ggggcgagggcaggggcgggggtgcatcagtcgctgatcttccgctag

DBGET integrated database retrieval system