KEGG   Pseudomonas fulva: Psefu_1939Help
Entry
Psefu_1939        CDS       T01501                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pfv  Pseudomonas fulva
Brite
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Psefu_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEF21912
UniProt: F6A8C5
LinkDB All DBs
Position
complement(2070359..2070880)
Genome map
AA seq 173 aa AA seqDB search
MKRWMMAALASCCAASLQAADKTVELNAVDANGVGSSVGKVVISQSPYGVVFTPELHDLE
PGIHGFHVHSKPSCEPAPKDGKPSAAEAAGGHWDPKKTGKHDLPWSDGHLGDLPALLVTA
DGKASQPVLAPRIKSVDELKGLSLMVHAGGDNHADHPKPLGGGGARVACGVIE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctggatgatggccgcactggccagttgctgcgcggccagcctgcaggctgcc
gacaagacggtcgaactcaacgcagtggacgcaaacggcgtcggcagctcggtgggcaag
gtggtgatcagccaaagcccttacggcgtggtgttcacgcccgagctgcatgacctggaa
ccggggattcacggcttccacgtacacagcaaacccagctgcgagccggcgcccaaggat
ggcaagccctctgcggccgaagccgccggcggccactgggatccgaaaaaaaccggcaag
cacgacctgccctggagcgatggccacctgggcgacctccctgctctgctggtgaccgct
gacggcaaggccagccagccggtactggcaccacgcatcaagagcgtggacgaactcaag
ggcctttcgctgatggtgcatgccggcggcgacaaccatgccgatcatcccaagcctctg
ggcggcggtggcgcacgcgtcgcctgcggtgtgatcgagtaa

DBGET integrated database retrieval system