KEGG   Pseudomonas fulva: Psefu_2332
Entry
Psefu_2332        CDS       T01501                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Psefu_2332
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     Psefu_2332
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA HI0933_like FAD_oxidored NAD_binding_8 Thi4 K_oxygenase NAD_binding_7 Hema_HEFG
Other DBs
NCBI-ProteinID: AEF22299
UniProt: F6ACB7
LinkDB
Position
complement(2503327..2504277)
AA seq 316 aa
MSEVKHSRLIILGSGPAGYSAAVYAARANLKPVIITGIQPGGQLTTTTEVDNWPGDVEGL
TGPGLMERMQKHAERFETEIIYDHIHTAELQSRPFTLKGDSGTYTCDALIIATGASAQYL
GLPSEEAFAGKGVSACATCDGFFYRNQVVAVIGGGNTAVEEALYLSNIAKEVHLVHRRDK
LRSEKILQDKIFDKAANGNIKLHWNHTLEEVLGDATGVTGARLRSTQDGTTTDLPLAGVF
IAIGHKPNTDLFQGQLEMRDGYLLVKGGSEGNATATSIEGVFAAGDVADHVYRQAITSAG
AGCMAALDVEKFLDDN
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagcgaagtcaagcattcccgcctgattattctgggctccgggccggccggttacagc
gccgccgtatacgccgctcgtgccaatctgaagcctgtcatcatcaccggtattcagcct
ggcggtcagctgaccaccaccaccgaggtcgacaactggccgggtgatgtggaagggctg
acgggaccggggctgatggagcgcatgcagaaacacgcagagcgcttcgaaaccgagatc
atctacgaccacatccacaccgccgagttgcagagccgtccgttcaccctcaagggtgac
agcggcacctacacctgcgatgcgctgatcatcgccacaggcgcttcggcgcagtacctg
ggcctgccctccgaagaagcgttcgctggcaagggcgtgtccgcctgcgcgacctgcgac
ggtttcttctaccgcaaccaggtggtcgcggtcatcggcggcggcaacaccgccgtggaa
gaagcgctgtacctgtccaacatcgccaaggaagtgcacctggtgcatcgccgcgacaag
ctgcgctcggagaagatcctgcaggacaagatcttcgacaaggcggccaacggcaatatc
aagctgcactggaaccacaccctggaagaagtactgggcgatgctaccggcgtgaccggc
gcgcgcctgcgcagcacccaggacggcaccaccaccgacctgccattggctggcgtgttc
atcgccatcggccacaagcccaataccgacctgttccagggccagctggaaatgcgtgac
ggctacctgctggtcaagggcggcagcgaaggcaacgccacagccaccagcatcgagggc
gtgttcgccgccggcgacgtggccgatcacgtctaccgccaggccatcacctcggccggc
gcgggctgcatggccgccctggatgtcgagaagttcctcgacgacaactga

DBGET integrated database retrieval system