KEGG   Pseudomonas fulva: Psefu_2491
Entry
Psefu_2491        CDS       T01501                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00010  Glycolysis / Gluconeogenesis
pfv00020  Citrate cycle (TCA cycle)
pfv00260  Glycine, serine and threonine metabolism
pfv00280  Valine, leucine and isoleucine degradation
pfv00310  Lysine degradation
pfv00380  Tryptophan metabolism
pfv00620  Pyruvate metabolism
pfv00630  Glyoxylate and dicarboxylate metabolism
pfv00640  Propanoate metabolism
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01200  Carbon metabolism
Module
pfv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_2491
   00020 Citrate cycle (TCA cycle)
    Psefu_2491
   00620 Pyruvate metabolism
    Psefu_2491
   00630 Glyoxylate and dicarboxylate metabolism
    Psefu_2491
   00640 Propanoate metabolism
    Psefu_2491
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psefu_2491
   00280 Valine, leucine and isoleucine degradation
    Psefu_2491
   00310 Lysine degradation
    Psefu_2491
   00380 Tryptophan metabolism
    Psefu_2491
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfv04147]
    Psefu_2491
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Psefu_2491
Exosome [BR:pfv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Psefu_2491
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 GIDA FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C HI0933_like 3HCDH_N NAD_binding_8 Thi4 2-Hacid_dh_C K_oxygenase Lycopene_cycl UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AEF22456
UniProt: F6AEN0
LinkDB
Position
complement(2678220..2679656)
AA seq 478 aa
MSQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYQDKDGKTALGGTCLNVGCIPSKAL
LDSSWKYHEAQDGFAVHGISAKGVSIDVPAMVGRKNTIIKNLTGGVAGLFKANGVTLLEG
HGKLLAGKKVEVTDKDGKTSVVEAENVILASGSRPIDIPPAPVDQDVIVDSTGALEFQAV
PKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEAVAKEAFKTLTKQGLDIK
LGARVTGSEVKKKQVTVNYTDAAGEQKIVFDKLIVAVGRRPVTTDLLASDSGVDLDERGY
IFVDDHCATSVPGVYAIGDVVRGMMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTH
PEIAWVGKTEQQLKGEGVAINVGTFPFAASGRAMAANDTGGFVKVIADANTDRVLGVHVI
GPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGGAIHIANRKKR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagccagaaattcgacgtggtagtcatcggtgccggccctggcggctatgtagccgcc
atcaaggctgcgcaactcggtctcaagaccgcgtgcatcgagaagtaccaggacaaggac
ggtaagaccgcactgggcggcacctgcctgaacgtcggttgcattccctccaaggcgctg
ctggacagctcctggaagtaccacgaagcccaggacggtttcgccgttcatggtatcagc
gccaagggcgttagcatcgacgtaccggccatggtcggtcgcaagaacaccatcatcaag
aacctgaccggcggcgttgccggcctgttcaaggctaacggtgtgactctgctcgaaggc
cacggcaagttgctggctggcaagaaagtcgaagttaccgacaaggacggcaagacctcc
gtcgtcgaagccgagaacgtgatcctggcttccggctcgcgtccgatcgacatcccgccg
gctccggtcgaccaggacgtgatcgtcgactccaccggcgccctggaattccaggccgta
ccgaagaagctgggcgttatcggcgctggcgtaatcggtctggagctgggttcggtctgg
gctcgcctgggcgctgaagtgaccgttctcgaagcgctggacaagttcctgccggccgct
gacgaagccgtcgccaaggaagccttcaagaccctcaccaagcagggtctggacatcaag
ctgggcgctcgcgttaccggctccgaagtcaagaagaagcaggtcaccgtcaactacacc
gacgccgctggcgagcagaagatcgttttcgacaagctgatcgttgcggtcggccgtcgc
ccggtgaccactgacctgctggcttcggacagcggcgtggacctggacgagcgtggctac
atcttcgtcgacgaccactgcgccaccagcgttccgggcgtttacgccatcggtgacgtg
gtgcgcggcatgatgctcgcccacaaggcctcggaagagggcgtgatggttgccgagcgc
atcgccggtcacaaggcgcagatgaactacgacctgatcccgtcggtcatctacacccac
ccggaaatcgcgtgggtcggcaagaccgagcagcagctcaagggcgaaggcgtggccatc
aacgtcggtaccttcccgttcgccgccagcggccgtgccatggcggccaacgacaccggc
ggtttcgtcaaggtcatcgctgacgccaacaccgaccgcgtgctgggcgttcacgtcatc
ggcccaagcgcggccgagctggtacagcagggcgccatcggcatggaattcggcaccagt
gccgaagacctgggcatgatggtgttctcgcacccaaccctgtccgaggcgctccacgaa
gccgccctggcagtcaacggtggcgcgatccacatcgccaaccgcaagaaacgctaa

DBGET integrated database retrieval system