KEGG   Pseudomonas fulva: Psefu_2816
Entry
Psefu_2816        CDS       T01501                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pfv  Pseudomonas fulva
Pathway
pfv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Psefu_2816
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pfv03400]
    Psefu_2816
Enzymes [BR:pfv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Psefu_2816
DNA repair and recombination proteins [BR:pfv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Psefu_2816
SSDB
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Other DBs
NCBI-ProteinID: AEF22780
UniProt: F6AI24
LinkDB
Position
complement(3035897..3038455)
AA seq 852 aa
MAKATSAYNRKRNFDSTSEPREPARRSRAKAGALTFVVQKHDARRLHYDFRLELEGTLKS
WAVPKGPSLDPSQKRLAVHVEDHPLAYASFEGSIAEGNYGAGDVIVWDHGIWQPEGDPVA
GYESGKLKFTLIGEKLSGAWTLVRTRLKGSGDKQQWLLIKEQDDVARPADEYDIVSELPA
SVISGELVGGMEKPAANQARKSQSRSKAPAKPSRKKAAKAAMPDSLSPELATLVESPPAG
DWLYEIKYDGYRIMARVKEGEVTLFSRNGHDWTARMAPQAKALEKLKLGDSWLDGEAVVL
DEQGMPDFQALQNAFDDARSGDILYFLFDAPWLDGVDQRELPVEQRRDALQKKLPKRKGP
LRFSEAFEVDHQSVLGSACALGLEGVIGKRAGSPYRSSRSADWIKLKCRQRQEFVVVGFT
KPQGSRSGFGALLLAVNEAKGLRYAGRVGTGFNEALLANLHKRMKALARDDSPLHKQPSA
AQRRGVQWIEPQLVVEVAFAGWTGEGLVRQGAFVGERSDKPAEQIIEEQPASAKAVEEGA
STEKTTSKAKARKGREQIGEVSVSHPERVIDEQSGTTKAQLARFYAEIADWLLPDVRNRP
VSLLRAPGGVGGEQFFQKHAERLAIPNIHHLDADLDPGHDRLMAIDSAPALIGAVQMGTI
ELHTWNAAYASIERPDRLILDLDPDPALPWRAVMEATRLSLSVLDELGLETFVKTSGGAG
MHLVVPLARHVDWDTLKAFGKAISQFMASELPDRFSARMGPKNRIGKVYLDYLRNGRGAS
TVAAYSVRARPGLPVSVPIRREELGQLRDSKQWHIGNLQQRLAKLDEDPWAGYANRQRIP
KAMWRKLGVEAP
NT seq 2559 nt   +upstreamnt  +downstreamnt
atggccaaggcaaccagtgcatacaaccgcaaacgcaatttcgactccaccagtgaaccc
cgcgaacccgcgcggcgcagccgagccaaggctggtgcgctgacgttcgtggtgcagaag
cacgacgcccggcgcctgcattacgactttcgcctggagctggaaggcaccctgaaaagc
tgggccgtgcccaagggcccgagcctggacccgagccagaagcgtctggcggtgcacgtc
gaggatcacccgctggcctacgccagcttcgagggcagcatcgccgagggcaattacggc
gcaggcgatgtgatcgtctgggatcacggcatctggcagcccgagggcgatcccgtcgcg
ggctatgaatccggcaagctgaaattcaccttgatcggcgagaagctaagtggcgcctgg
acgctggtgcgcacacgcctgaaaggcagcggcgacaagcagcaatggctgctgatcaag
gagcaggacgacgtggcccggccggctgacgagtacgacatcgtcagcgagctgccggcc
agcgtgatcagcggcgagctggtgggtggcatggaaaagcccgccgccaaccaggcgcgc
aagagccagtcgcgcagcaaggcacctgccaagccgagccgcaagaaagccgccaaggcg
gccatgccggacagcctgtcgccagagttggccaccctggtcgagtcgccgccggccggc
gactggctctacgagatcaaatacgacggctaccggatcatggcccgcgtcaaagaaggc
gaggtgaccctgttcagccgcaacggccatgactggacggcgcgcatggcgcctcaggcc
aaggcgctggagaagctcaagctcggcgacagctggctggacggcgaggctgtggtactc
gatgagcagggcatgccggatttccaggctttgcagaacgccttcgatgacgcccgtagc
ggcgacatcctgtatttcctgttcgacgcgccctggctcgatggcgtcgaccaacgcgag
ttgccggtcgagcagcgccgcgacgcactgcagaagaaattgcccaagcgcaaaggcccg
ctgcgtttctccgaggcgttcgaggtcgatcaccagagcgtgctgggcagcgcctgcgcc
ctgggcctggaaggtgtgatcggcaagcgcgccggcagcccgtaccggtcctcgcgcagc
gccgactggatcaagctcaagtgccggcagcgccaggagttcgtggtggtcggtttcacc
aagccacagggcagccgctcgggcttcggtgcgcttttgctggcggtcaacgaggcgaag
ggcctgcgctacgccggacgggtcggcaccggcttcaacgaggcgctgctcgccaacctg
cacaagcgcatgaaagccctggcgcgggacgactcgccgctgcacaagcagcccagcgcg
gcgcagcgccgtggcgtgcagtggatcgagccgcaattggtggtcgaggtggcctttgcc
ggctggactggagaaggcctggtgcgtcagggtgccttcgtcggcgagcgcagtgacaag
ccggccgagcagatcatcgaggaacagcctgcgtcagccaaggcggtagaagagggcgca
tccaccgagaaaacgaccagcaaggctaaagcccgcaagggccgtgagcagatcggcgaa
gtatcggtgagccacccggagcgggtcatcgatgagcagagcggtactactaaggcgcag
ctggcacgcttctacgccgagattgccgactggctgctgcccgacgtgcgcaaccggccg
gtatcgttgctgcgcgcaccaggcggcgttggcggcgagcagttcttccagaagcatgcc
gagcgcctggcgattcccaatattcatcatctggatgccgacctcgatcccggccatgac
cgcttgatggctatcgatagcgcaccggccctgatcggtgccgtgcagatgggcaccatc
gagttgcacacctggaatgcggcgtacgccagcatcgaacggccggaccggctgatcctc
gacctcgatccggacccggcgctgccctggcgcgccgttatggaggccacccgcctgagc
ctctcggtgctcgacgagctgggcctggaaaccttcgtgaaaaccagcggcggtgccggc
atgcacctggtggtgccgttggcccggcatgtcgactgggacacgcttaaggctttcggc
aaggcgatctcgcagttcatggccagcgaattgccggatcgcttcagcgcccgcatgggc
ccgaagaaccgcatcggcaaggtgtatctggattacctgcgcaacggtcgcggtgccagc
accgtggccgcctattcggtgcgtgcgcggccgggcttgccggtatcggtgccgatccgc
cgcgaggaactggggcaattgcgcgactcgaagcagtggcatatcggcaatctgcaacag
cgcctggccaagctcgacgaggatccctgggccggctatgccaatcgccaacgcatcccc
aaagccatgtggaggaagctcggcgtcgaggcgccctga

DBGET integrated database retrieval system