KEGG   Pseudomonas fulva: Psefu_3358Help
Entry
Psefu_3358        CDS       T01501                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
pfv  Pseudomonas fulva
Pathway
pfv00910  Nitrogen metabolism
pfv02010  ABC transporters
Module
pfv_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Psefu_3358
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Psefu_3358
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfv02000]
    Psefu_3358
Transporters [BR:pfv02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Psefu_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEF23320
UniProt: F6ABR1
LinkDB All DBs
Position
3615481..3616326
Genome map
AA seq 281 aa AA seqDB search
MNAPVKSLALPAGVVAPSWLKRLSKTLMQSVLPPLVITAALMLIWQLLCSGANAALPPPS
QVIEDTWELIVNPFYDNGGTDVGMAWQLLASLERVAYGYALAVVVGVALGVLVGQSTWAM
RGLDPLFQILRTVPPLAWLPLSLAGFKDSHPSALFVIFITAIWPIIINTSVGIRNIPEDY
RNVAKVLRLNGVEYFQKIMLPAAAPYIFSGLRIGVGLSWLAIIAAEMLIGGVGIGFFIWD
AWNASRISDIILALIYVGVVGFLLDRLVLFVGNRITRGTSA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcccgtcaaatccctggccctgccggccggcgtcgtcgcccccagttggctc
aaacgcctgtcgaaaaccctgatgcagtcggtgctgccgccgctggtgatcaccgctgcg
ctgatgctgatctggcaactcttgtgcagcggcgccaacgccgccctgccgccgccgagc
caggtgatcgaagacacctgggagctgatcgtcaacccgttctacgacaacggcggcacc
gatgtcggcatggcctggcagttgctcgccagcctggagcgcgtggcctacggctatgcc
ctggcggtggtggtcggcgtagccctcggcgtgctggtcggccagtcgacctgggcgatg
cgtggcctcgacccgctgttccagatcctgcgtaccgtgccgccgctggcctggctacca
ctgtcgctggccggcttcaaggacagccatccctcggcgctgttcgtgatcttcatcacc
gccatctggccgatcatcatcaatacctcggtgggcatccgcaacattcccgaggactac
cgcaacgtcgccaaggtgctgcgcctcaacggcgtcgagtacttccagaagatcatgctg
ccggccgccgcgccgtacatcttctccgggctgcgcatcggcgtgggcctgtcgtggcta
gcgatcatcgccgccgagatgctgatcggcggcgtgggtatcggcttcttcatctgggat
gcgtggaacgcctcgcgcatcagcgacatcattctcgccctgatctacgtcggcgtggtc
ggcttcctgctcgaccgcctggtgctgttcgtcggcaatcgtatcacccgcggcacatcg
gcctga

DBGET integrated database retrieval system