KEGG   Pseudomonas fulva: Psefu_3370
Entry
Psefu_3370        CDS       T01501                                 

Definition
(GenBank) thioredoxin reductase
  KO
K22345  glucosaminate ammonia-lyase [EC:4.3.1.9]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psefu_3370
Enzymes [BR:pfv01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.9  glucosaminate ammonia-lyase
     Psefu_3370
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored FAD_binding_2 HI0933_like Thi4 NAD_binding_7 NAD_binding_8 K_oxygenase AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AEF23332
UniProt: F6ABS3
LinkDB
Position
complement(3626096..3627043)
AA seq 315 aa
MSSTRHARVIILGSGPAGYSAAVYAARANLKPLLITGLQAGGQLTTTTEVDNWPGDAHGL
TGPELMQRMQAHAERFETEIVFDHIQAVDLAARPFTLVGDSISYTCDALIIATGASARYL
GLPSETAFMGKGVSACATCDGFFYRNREVAVVGGGNTAVEEALYLANIASRVTLIHRRGA
FRAEKILQNKLQARVAEGRIVLALNAEVDEVLGDDSGVTGVRIREQDGGTRDLAVDGLFV
AIGHTPNTALFERQLALKDGYLQVNGGRDGNATATTVPGVFAAGDVADSVYRQAITSAGA
GCMAALDVERFLDGL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtcgagtacccgacacgcccgcgtgatcattctcggttccggcccagctggctatagc
gcggcggtctacgccgcgcgtgccaatctcaagccgctgttgatcaccggcctgcaggcc
ggcgggcagctgaccaccaccaccgaagtggacaactggcccggcgacgcccacggcctg
accgggccggagctgatgcagcgcatgcaggcccacgccgagcgcttcgagaccgaaatc
gtcttcgaccatatccaggccgtggacctggccgcgcgtcccttcaccctggtgggcgac
agtatttcctacacctgcgatgcgctgatcatcgctaccggggccagtgcccgctatttg
ggcctgccgagcgaaacggcgttcatgggcaagggcgtttcggcgtgcgccacctgtgac
ggcttcttctaccgcaaccgtgaagtggcggtggtcggcggcggcaataccgcagttgaa
gaggcgctttatctggccaacatcgccagccgggtgactctgattcatcgccgtggtgcg
ttccgcgccgagaagatcctgcagaacaagctgcaggcgcgggtggccgaagggcgtatc
gtgctggcgctgaatgccgaggtggatgaggtgctgggcgacgactcgggtgttaccggc
gtacgcattcgcgagcaggatggcggcactcgcgatctggccgtggatggcctgttcgtc
gccatcggccacacgcccaataccgcgttgttcgaaaggcaactggcgctcaaggacggt
tatctgcaggtcaatggtgggcgtgatggcaatgccaccgcgaccaccgtgccgggcgtg
ttcgctgcaggcgatgtagccgacagcgtttaccgccaagccatcacctcggcaggtgcc
ggctgcatggcggcgctggatgtggagcgttttctcgacgggctgtaa

DBGET integrated database retrieval system