KEGG   Pseudomonas fulva: Psefu_3563Help
Entry
Psefu_3563        CDS       T01501                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00473  D-Alanine metabolism
pfv00550  Peptidoglycan biosynthesis
pfv01100  Metabolic pathways
pfv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Psefu_3563
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psefu_3563
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Psefu_3563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfv01011]
    Psefu_3563
Enzymes [BR:pfv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Psefu_3563
Peptidoglycan biosynthesis and degradation proteins [BR:pfv01011]
 Precursor biosynthesis
  Amino acid ligase
   Psefu_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATPgrasp_Ter ATP-grasp ATP-grasp_3 ATPgrasp_YheCD ATP-grasp_5 RimK TTL
Motif
Other DBs
NCBI-ProteinID: AEF23525
UniProt: F6AE13
LinkDB All DBs
Position
complement(3834503..3835453)
Genome map
AA seq 316 aa AA seqDB search
MSAETLKSQLPVAAFGRVAVLFGGKSAEREVSLKSGNAVLSALQSAGVDAFGIDVGDDFL
ARLSNEKIDRAFIVLHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWQSL
GLSTPRHAVLSSADDCRRAADELGFPLIVKPAHEGSSIGMAKVGDVDSLIAAWQDAACYD
SQVLVEQWIQGPEFTIAMLRGEVLPPIALGTPHSFYDYDAKYLANDTQYRVPCGLSADKE
AELKALTARACEAVGTQGWARADVMQDTDGRFWLLEVNTVPGMTDHSLVPMAAQAAGLDF
QQLVLAILADSVEARG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgaaaccctgaaatcacaactgccggtcgccgccttcggtcgcgtcgccgta
ctgttcggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcaatgccgtgctg
agcgcgctgcagagcgccggcgtggacgccttcggcatcgacgtgggcgatgacttcctg
gctcgtctgagcaacgagaagatcgaccgcgcctttatcgtgctgcacggccgtggcggt
gaggacggcagcatgcagggtctgctcgagtgcgccggcattccctacaccggcagcggc
atcctggcttcggccctggccatggacaagctacgcaccaagcaggtgtggcagagcctg
ggcctgtccacgccgcgccatgcggtgctgagcagcgccgacgattgccgccgcgccgcc
gacgagttgggcttcccgctgatcgtcaaaccggcccacgaaggctcgagcatcggcatg
gccaaggtcggcgacgtcgactccctgatcgccgcctggcaggacgctgcctgctacgac
agccaggtgctggtcgagcagtggatccagggcccggagttcaccatcgccatgctgcgt
ggcgaggtgctgccaccgatcgccctgggcacgccgcacagcttctacgactacgacgcc
aagtacctggccaatgacacccagtatcgtgtgccctgcggcctgtcggctgacaaggaa
gcagaactgaaggccctgaccgcccgcgcctgcgaagccgttggcacccagggttgggcc
cgcgccgacgttatgcaggacaccgacggccgtttctggctgctggaggtgaacaccgtt
ccgggtatgaccgaccacagcctggtgccgatggcagcgcaggcggccggtctggatttc
cagcagctggtgttggcgattctcgctgacagcgtcgaggctcgggggtaa

DBGET integrated database retrieval system