KEGG   Pseudomonas fulva: Psefu_3696Help
Entry
Psefu_3696        CDS       T01501                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00970  Aminoacyl-tRNA biosynthesis
pfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Psefu_3696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pfv03029]
    Psefu_3696
Enzymes [BR:pfv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Psefu_3696
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Psefu_3696
Mitochondrial biogenesis [BR:pfv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Psefu_3696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEF23657
UniProt: F6AF13
LinkDB All DBs
Position
3966419..3967870
Genome map
AA seq 483 aa AA seqDB search
MHQLTLAEIARALADKQFSSAELTGSLLSRIEQLDPQLNSFITVTAEQALEQAKAADARR
AAGENGPLLGAPIAHKDLFCTQGVLTSCGSKILTGFKAPYDATVVDKLKAAGTVTLGKLN
MDEFAMGSANESSHYGPVKNPWDTSRVPGGSSGGSAAAVAARLLPAATGTDTGGSIRQPA
ALTNLTGIKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALLLGAMAGFDAKDSTSVDQ
PVDDYLAALAQPLAGLRIGLPKEYFGAGLDARIGEKIMAVVEELKKLGATVKDISLPNLQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCENPKDLQDLYKRSRGEGFGEEVKRRIMVGT
YALSAGYYDAYYIKAQQIRRLIKNDFVAAFKEVDVILGPTTPNLAWKLGEKNADPVSAYL
EDIYTITANLAGIPGLSMPAGFVDGLPVGVQLLGNYFQEGRLLNVAHQYQQVSDWHKQAP
SGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaattgaccctggccgagatcgcccgcgcactcgccgacaagcaattctcttcc
gccgagctgaccgggagcctgctgagccgcatcgagcagctcgatccgcagctcaacagc
ttcatcaccgtcaccgcagagcaagccctcgagcaggcaaaggccgccgacgcccgccgc
gctgccggtgaaaacggcccgctgcttggcgcgccgatcgcccacaaggacctgttctgc
acccagggcgtgctgaccagctgcggctcgaagatcctcaccggcttcaaggcaccctac
gacgccaccgtggtcgacaagctcaaggccgccggcaccgtgaccctcggcaagctgaac
atggacgagttcgctatgggctcggccaacgaatccagccactacggcccggtcaagaac
ccctgggacaccagccgcgtacccggcggttcttcgggtggctcggctgcagccgtagcg
gcgcgcctgctgccggccgccaccggcaccgacaccggcggctcgatccgtcagccggcg
gcgctgaccaacctcaccggtatcaagcccacctacggccgcgtgtcgcgctggggcatg
atcgcctacgcctccagcctcgatcagggcggcccgctggcccgcaccgccgaggattgc
gccctgctgctcggcgccatggccggtttcgatgccaaggattcgaccagcgtcgatcag
ccggtcgatgattacctggccgccctcgcccagccgctggccggcctgcgcatcggcctg
cccaaggaatacttcggtgccggcctcgacgcacgcatcggcgagaagatcatggccgtg
gtcgaggagttgaaaaagctcggcgccaccgtcaaggacatcagcctgccaaacctgcag
cacgccatcccggcctactacgtgatcgcgccggccgaggccagctcgaacctgtcgcgc
ttcgacggcgtgcgtttcggctatcgctgcgagaacccgaaagacctgcaggacctgtac
aagcgctcccgtggcgaaggcttcggcgaggaagtgaagcgccgcatcatggtcggcacc
tatgcgttgtccgccggttactacgatgcttactacatcaaggcccagcagatccgccgg
ttgatcaagaacgacttcgtcgccgccttcaaagaggtcgacgtgattctcggcccgacc
acgccgaacctggcctggaagctcggcgagaagaacgccgacccggtctccgcctacctg
gaagacatctacaccatcaccgccaacctggccggcatccccggtctgtcgatgccggcc
ggcttcgtcgatggcctgccggtgggcgtgcagctgctcggcaactacttccaggaaggt
cgtctgctcaacgtcgcgcaccagtaccagcaggtcagcgactggcacaaacaagcaccg
agcggattctga

DBGET integrated database retrieval system