KEGG   Pseudomonas fulva: Psefu_4311Help
Entry
Psefu_4311        CDS       T01501                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00010  Glycolysis / Gluconeogenesis
pfv01100  Metabolic pathways
pfv01110  Biosynthesis of secondary metabolites
pfv01120  Microbial metabolism in diverse environments
pfv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psefu_4311
Enzymes [BR:pfv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Psefu_4311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEF24263
UniProt: F6A9H3
LinkDB All DBs
Position
4704554..4705450
Genome map
AA seq 298 aa AA seqDB search
MSTSNERIQLGDLACWRIQHAGAELVVSEQGAQILRYQPAQGEPLIWLSDEAAYKTGKSV
RGGVPVCWPWFGDLQRNPEAIRASHARPADSPAHGLVRDRDWQLIGLNTEEDGVTLSFTF
DTAAEPIAEWPHAAELQLDIHLGERLKLSLTTRNLGDSELPISQALHTYFAVSDIRQVRI
EGLEGCGYVDTLQDWKTVRQDGAVTFSGETDRIYLDTPPQLSIVDPIWKRRILMRSQGSA
SAVVWNPWIDKAKRLSQFADDAWQGMLCIEHANVLDDSLILAPGAEYRLDVTLWAQPL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctccaacgaacgcattcaactgggcgatctggcctgctggcgcatccagcat
gccggcgccgaactcgtggtcagcgaacagggcgcgcagatcctgcgctaccagccggcc
cagggcgaaccgctgatctggctcagcgacgaggcggcctataaaaccggaaaaagcgtg
cgcggcggcgtgccggtgtgctggccctggttcggcgacctgcagcgcaatcccgaagcg
atccgcgccagccatgcgcgtccggccgattcgccggcccatggcctggtgcgtgaccgc
gactggcagctgatcggcctgaacaccgaagaagacggcgtgaccctgtcgttcaccttc
gacaccgccgccgagccgatcgccgaatggccgcatgccgccgagctgcagttggacatt
cacctcggcgagcgcctgaaacttagtctgaccacccgcaacctgggcgatagcgaactg
ccgatcagccaggcgctgcacacctacttcgcggtcagcgacattcgccaggtgcgcatc
gaaggtctggagggctgcggctacgtcgacacgttgcaggactggaaaaccgtaagacag
gacggcgcggtgaccttcagcggtgaaaccgaccgtatctacctcgatacgccgccgcaa
ctgagcatcgtcgaccccatctggaagcggcgcatcctgatgcgcagccaaggctcggcc
tcggcggtggtgtggaacccatggatcgacaaggccaagcgcctgtcgcaattcgccgat
gacgcctggcagggcatgctctgcatcgagcacgccaacgtgctggacgactcgctgatc
ctcgccccgggcgccgagtaccgcctcgacgtgacgctgtgggcgcagccactttga

DBGET integrated database retrieval system