KEGG   Pseudomonas fulva: Psefu_4421
Entry
Psefu_4421        CDS       T01501                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00330  Arginine and proline metabolism
pfv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Psefu_4421
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     Psefu_4421
SSDB
Motif
Pfam: Pyr_redox_2 FAD_oxidored FAD_binding_2 GIDA HI0933_like DAO NAD_binding_8 NAD_binding_9 Thi4 FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C NAD_binding_7 Lycopene_cycl Pyr_redox 3HCDH_N
Other DBs
NCBI-ProteinID: AEF24373
UniProt: F6AAE6
LinkDB
Position
4825258..4826517
AA seq 419 aa
MKQSTDVLIIGAGPAGLSAALAAANDGARVVLVDDNPLLGGQIWRDGAQARLPAQARQLR
DAVDNHATIQRHEATRVVARAGKNGLLVEDVERGWVIDYHRLILCTGARELLLPFPGWTL
PGVTGAGGLQALIKGGLPVAGERIVIAGSGPLLLASASTAKHSGAQVLRIAEQATARSVA
RFALQLPRWPHKLLQAFALFDANYHTRTRIIAALGSDRLEGVRLQRGDQIEELQCERLAC
GFGLIANTGLGQAFGCALVNDAIGVDTWQATNVAGLYAAGECTGFGGSELALVEGRIAGH
AAAGNRGAAQRLWPARARWQRFADALHEHFALDPALKRLAEADTLLCRCEDVPYAAVAAH
ASWREAKLATRCGMGACQGRVCGAAAQHLFGWQSPAPRPPFSPARIDTLTRLGEPEQSA
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgaagcagagcaccgacgtgctgatcatcggcgccggcccggccggtctgtcggccgcc
ctggctgccgccaacgacggcgcgcgggtggtgctggtcgacgacaacccgctgctcggc
gggcagatctggcgcgatggagcacaggccaggttgccggcccaggcccgccagttgcgt
gacgctgtggataaccacgccaccatccagcgccacgaggccacgcgggtggtcgccaga
gccggcaagaacggtctgctggtcgaggatgtcgagcgcggctgggtgatcgactatcac
cgcctgatcctgtgcaccggcgcgcgcgagctgctgctgccctttcccggctggacgctg
cccggtgttaccggcgccggcggcctgcaggcattgatcaagggcgggctgccggtggcc
ggcgagcgcatcgtgattgccggcagtggcccgctgctgctggcctcggcaagcaccgcg
aagcacagcggcgctcaggtgctgcgtatcgccgagcaggcaaccgcccgctcggtcgcc
cgcttcgccttgcagctgccgcgctggccacacaagctgctgcaggcctttgccctgttc
gatgccaactaccacacacgcacgcggatcatcgccgcgctgggctccgatcgcctggaa
ggcgtgcgcctacagcgtggcgatcagatcgaggaactgcaatgcgagcgcctggcctgc
ggcttcggcctgatcgccaacaccgggctcggccaggctttcggctgcgcactggtcaac
gacgccatcggcgtggacacctggcaggcgaccaacgtagcgggcctttacgcagctggc
gaatgcaccggcttcggcggtagcgaactggcgctggtggaaggccgtatcgccgggcat
gccgcggccggcaaccgcggcgcagcgcagcgactatggccggcacgcgcacgctggcag
cgcttcgccgatgccctgcacgaacacttcgccctcgacccggcgctcaaacgcctggcc
gaagcggacaccctgctgtgtcgctgcgaagatgtgccctacgcggccgtggccgcacac
gccagctggcgcgaagcgaaactggcgacccgttgcggcatgggcgcctgccagggtcgg
gtgtgcggggccgcggctcagcatctgttcggctggcagtcgccggcgccgcgcccaccc
ttcagcccggcgcgcatcgacacgctcacgcggttgggcgagccagaacagagcgcttag

DBGET integrated database retrieval system