KEGG   Pseudomonas simiae PCL1751: PF1751_v1c09080Help
Entry
PF1751_v1c09080   CDS       T03766                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw00471  D-Glutamine and D-glutamate metabolism
pfw00550  Peptidoglycan biosynthesis
pfw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PF1751_v1c09080 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PF1751_v1c09080 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfw01011]
    PF1751_v1c09080 (murC)
Enzymes [BR:pfw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     PF1751_v1c09080 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:pfw01011]
 Precursor biosynthesis
  Amino acid ligase
   PF1751_v1c09080 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AJP50614
UniProt: A0A4U3GDB4
LinkDB All DBs
Position
1032419..1033864
Genome map
AA seq 481 aa AA seqDB search
MVENQKAMPQPEMRRIRRIHFVGIGGVGMCGIAEVLLNLGYQVSGSDLKESPVTERLKTF
GAQIFIGHRAENAAEADVLVVSSAVNTSNPEVATALERRIPVVPRAEMLAELMRYRHGIA
VAGTHGKTTTTSLIASVFAAGGLDPTFVIGGRLNAAGTNAQLGTSRYLIAEADESDASFL
HLQPLVAVVTNIDEDHMATYDGDFNKLKKTFVEFLHNLPFYGLAVVCLDDPVVREILPLV
KRPTVTYGFSEDADVRAINVRQEGMQTFFTVLRPDREPLDVSVNMPGNHNVLNSLATICI
ATDEGVSDEAIVEGLSRFAGVGRRFQVYGQLPVDGGDVMLVDDYGHHPTEVAAVIKAVRG
GWPERRLVMVYQPHRYSRTRDLYDDFVNVLADANVLLLMEVYPAGEEPIPGADSRKLCNS
IRQRGQLDPIYIERGVDLAPIVKPLLRAGDILLCQGAGDIGGLAPKLLASPLFAAAKGKS
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaatcagaaagccatgccgcaaccggaaatgcgccgcatccgtcgtatccac
ttcgtcggcattggcggcgtgggcatgtgtggcattgccgaagtgttgctgaacctgggc
taccaggtgtccggctctgacttgaaagagtcgccggtcactgaacgcctgaaaaccttt
ggtgcacagatcttcatcggccaccgcgccgagaacgccgccgaggccgatgtgctggtg
gtgtccagcgccgtgaacacctccaacccggaagtggccactgcccttgaacgtcgcatt
cccgtggtgccacgcgccgagatgctggccgagctgatgcgctatcgccacggcattgcc
gtcgccggtacccacggcaaaaccaccaccaccagcctgatcgcctccgtgttcgcggcc
ggtggcctggacccgacgttcgtcatcggtggccgtctgaatgcagccggtaccaatgca
caactgggcaccagccgttacctgatcgccgaagccgacgaaagtgacgcgagcttcctg
cacctgcaaccgctggtcgccgtggtcaccaatatcgacgaagaccacatggcgacctac
gacggggacttcaacaagttgaagaaaaccttcgtcgagttcctgcacaacctgccgttc
tacggtctggccgtggtgtgcctggacgatccggtggtgcgtgaaatcctgccactggtc
aagcgtccgaccgtgacctacggcttcagcgaagacgctgacgtgcgcgcgatcaatgtg
cgccaggaaggcatgcaaaccttctttaccgtgttgcgtcccgaccgcgagccgctggat
gtatcggtgaacatgccgggcaaccacaacgtactcaattccctggcgaccatctgcatc
gccaccgacgagggcgtcagcgatgaagccatcgtcgaaggcctgtcgcgcttcgccggc
gtgggccgccgtttccaggtatacggccagttgccggtagacggtggtgacgtgatgctg
gtggacgactacggtcaccacccgactgaagtggctgccgtgatcaaggccgtacgcggt
ggctggccggagcgccgtctggtgatggtctaccagccgcaccgctacagccgtacccgc
gacctgtatgacgacttcgtcaatgtactggccgatgccaacgtgctgctgctgatggaa
gtctacccggccggtgaagaaccgattccgggcgccgacagccgcaagctgtgcaacagc
atccgtcagcgtggccagttggacccgatctacatcgagcgtggtgtggacctggcgccc
atcgtcaagccgctgctgcgggccggtgacattttgctgtgccagggggccggtgatatc
ggtggtcttgcgcctaagttgctggcgagcccgctgtttgcagcggccaaggggaagtcg
aaatga

DBGET integrated database retrieval system