KEGG   Pseudomonas fluorescens PCL1751: PF1751_v1c09090Help
Entry
PF1751_v1c09090   CDS       T03766                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfw  Pseudomonas fluorescens PCL1751
Pathway
pfw00473  D-Alanine metabolism
pfw00550  Peptidoglycan biosynthesis
pfw01100  Metabolic pathways
pfw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PF1751_v1c09090 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PF1751_v1c09090 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PF1751_v1c09090 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfw01011]
    PF1751_v1c09090 (ddlB)
Enzymes [BR:pfw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PF1751_v1c09090 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pfw01011]
 Precursor biosynthesis
  Amino acid ligase
   PF1751_v1c09090 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 ATPgrasp_Ter ATPgrasp_YheCD GARS_A
Motif
Other DBs
NCBI-ProteinID: AJP50615
LinkDB All DBs
Position
1033861..1034817
Genome map
AA seq 318 aa AA seqDB search
MINDYGSLFSTIAPADFGRVAVLFGGKSAEREVSLKSGNAVLDALQTAGVNAFGIDVGDD
FIARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHSVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDAS
KEQELMDLTAKACEALGIAGWARADVMQDDQGDFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSIEPRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgactacggctccctgttctcgacaatcgcacctgccgactttggtcgcgta
gcggtgttgttcggtggcaaaagcgctgaacgcgaagtctcgctcaagtccggcaacgcc
gtgctcgacgccctgcaaaccgcaggcgtgaacgccttcggcatcgacgtgggcgatgac
ttcatcgcccgcctgcaggccgagaagatcgaccgcgccttcatcatcctccacggccgt
ggcggtgaagacggcagcatgcaaggcctgctggagtgcgccggcatcccctacaccggc
agtggcatcctggcttccgcgctggcgatggacaagttgcgcaccaaacaggtgtggcac
agcctgggtattccgaccccgcgtcacagtgttctgtgcagcgaagacgattgtatttct
gcagccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggccaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgattcgcaagtgttggtggaacagtggatccagggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccgcctatcgcattgggcacgccccacaccttttacgactac
gacgccaagtacctggcttccgatacccagtaccggatcccatgcggccttgacgcaagc
aaagaacaggaattgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tgggcgcgagcagacgtgatgcaggatgaccaaggggatttctggttcctggaagtcaac
accgcaccgggcatgacggatcacagcttggtacctatggcagcccgtgcggccggtttg
gacttccagcagttagtgctggcgatcctggccgacagcattgagccaagaggctaa

DBGET integrated database retrieval system