KEGG   Pseudomonas simiae PCL1751: PF1751_v1c15860
Entry
PF1751_v1c15860   CDS       T03766                                 

Definition
(GenBank) decarboxylase
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw00230  Purine metabolism
pfw00240  Pyrimidine metabolism
pfw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PF1751_v1c15860
   00240 Pyrimidine metabolism
    PF1751_v1c15860
Enzymes [BR:pfw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     PF1751_v1c15860
    3.2.2.-  
     PF1751_v1c15860
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AJP51289
UniProt: A0A5E7B8S8
LinkDB
Position
complement(1765195..1766568)
AA seq 457 aa
MPQRQVINASVSPKGSLETLSQREVQQLSEAGTGSIYTLFRQCALAILNTGAHIDNAKTI
LDAYKDFEVRIHQQDRGVRLELLNAPADAFVDGEMIASTREMLFSALRDIVYTENELDSQ
RIDLSNSQGITDYVFHLLRNARTLRPGVEPKIVVCWGGHSINTEEYKYTKKVGHELGLRS
LDVCTGCGPGVMKGPMKGATISHAKQRITGGRYLGLTEPGIIAAEAPNPIVNELVILPDI
EKRLEAFVRVGHGIIIFPGGAGTAEEFLYLLGILMHPDNRDLPFPVILTGPKHAAPYLQQ
LHAFVGATLGEAAQAHYQIIIDDPAEVARQMTVGLKAVKQFRRERNDAFHFNWLLKIDEG
FQRPFDPTHENMASLQLSHALPPHELAANLRRAFSGIVAGNVKDKGIRLIEQNGPYEIHG
DPAIMKPLDELLQAFVAQHRMKLPGGAAYVPCYRVVQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgccccaacgtcaagtcatcaatgcgtccgtcagccccaaaggcagcctcgaaaccctg
tcccaacgtgaagtccagcaactgagcgaagccggtaccggcagcatctacaccctattc
cgccagtgcgccctggcgatcctcaacaccggcgcgcacatcgacaacgccaagaccatt
ctcgacgcctacaaagacttcgaagtgcgcattcatcaacaggaccgtggcgtgcgcctg
gaattgctgaacgcccccgccgatgccttcgtcgatggcgaaatgatcgccagcacccgc
gaaatgctgttcagcgccctgcgtgacatcgtctacaccgaaaacgagttggacagccag
cgcatcgacctgagcaactcccagggcatcacagactatgtgttccacctgctgcgcaac
gcccgtacgctacgccccggtgtcgagccgaaaatcgtggtgtgctggggcgggcactcg
atcaataccgaagaatacaaatacaccaagaaagtcggccacgaactgggcctgcgcagc
ctcgacgtgtgcacgggctgcggccccggcgtgatgaaaggtcctatgaaaggcgcgacc
atttcccacgccaagcaacgcattaccggcgggcgctaccttggcctgaccgagccgggc
atcatcgccgccgaagcgccgaacccgatcgtcaatgagctggtgatcctgccggacatc
gaaaaacgcctggaagccttcgttcgcgtcggccacggcatcatcatcttcccgggcggt
gcgggcacggccgaagagttcctgtacctgctgggtatcctgatgcacccggacaaccgc
gacctgcccttcccggtcatcctcaccgggccgaaacatgccgcgccgtacctgcaacag
ttgcacgcattcgtcggtgccaccctgggcgaagcggcgcaagcgcactaccagatcatc
atcgatgacccggccgaagtggcgcgccagatgaccgtcggcctcaaggccgtgaagcag
ttccgccgcgagcgcaacgacgcgttccacttcaactggctactgaagatcgacgaaggc
ttccagcgcccgttcgacccgacccacgagaacatggcgagcctgcaactgagccacgca
ttgccgccccacgaactcgccgccaacttgcgccgtgcgttctccgggatcgtggccggt
aacgtaaaggacaaaggcatccgcctgatcgagcagaacggtccttacgaaatccacggt
gacccggccatcatgaaaccgctggacgagctgctacaggcgtttgtcgcccagcaccgc
atgaagctgccaggcggcgcggcgtatgtgccgtgttatcgagtggttcagtaa

DBGET integrated database retrieval system