KEGG   Pseudomonas fluorescens PCL1751: PF1751_v1c20700Help
Entry
PF1751_v1c20700   CDS       T03766                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pfw  Pseudomonas fluorescens PCL1751
Pathway
pfw00010  Glycolysis / Gluconeogenesis
pfw00052  Galactose metabolism
pfw01100  Metabolic pathways
pfw01110  Biosynthesis of secondary metabolites
pfw01120  Microbial metabolism in diverse environments
pfw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF1751_v1c20700
   00052 Galactose metabolism
    PF1751_v1c20700
Enzymes [BR:pfw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PF1751_v1c20700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AJP51772
LinkDB All DBs
Position
complement(2295681..2296829)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLALSMLVASGGAQAAGLTSEHKPFGKTNDGTAVEQYVLRNSHGMQATVIT
YGGVLQSLKVPDKHGKVEDVVLGFDDVQGYQSGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKHVWKATPVKAKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDNNELHIDYTATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGKLAPVKGTPMDFLKPTPIGQHIKDDHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLFTTEPGVQFYTSNFLDGSVKGKAGKTYLHWSGFTLETQHFPDAPNQPKF
ASTRLNPGQTYTQNTVFKFSAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgttacctgctctccggcctcgccctgtccatgctggtcgccagtggc
ggcgcccaggctgcaggccttaccagcgagcacaaacctttcggtaaaaccaacgacggc
accgccgtcgaacagtacgtgttgcgcaacagccatggcatgcaagccacggtgattacc
tacggcggcgtgttgcagtcgctgaaggtgccggacaagcacggcaaggtcgaggacgtg
gtgctgggcttcgacgacgtgcagggctatcaaagcggtacggcgtttttcggcgcgacc
atcgggcgcttcggcaatcgcctcgcgggcggtgccttcgagctcgacggcaagcgttac
caggttccgctcaacgatggccccaactcgctgcatggcggcgcccagggcttcgacaag
cacgtatggaaagccacgcccgtcaaggccaaggactccgtgggcgtgaccctcacctac
ctgtccaaggacggtgaaatgggcttccccggcaacctgaagaccgaggtcacctaccgc
ctcaacgacaacaacgaactgcacatcgattacaccgccaccaccgacaaacccacggtg
ctcaacctcaccaaccacagctacttcaacctcgccggtgcgggcaatggcgacatcctc
aagcaagtcgctaccttgcatgccagtcattacacgccggtgaatgccaccttgatccct
accggcaaactggcacctgtcaaaggcacgccgatggacttcctcaagcccacgccgatc
ggccagcacatcaaggacgatcacccgcagctcaaattcgccgagccgaaacagggaggg
ttcgacttcaactgggcgctggataccaaaggtgatgtgaaacagcttgcggccgaggtg
catgatcctgagtccggacggcgtttgcagctgtttaccacggagcctggggtgcagttc
tacaccagcaacttcctggatgggtcggtgaagggcaaggctgggaagacctacctgcac
tggagcgggttcacgctggagacccagcattttccagatgcgcccaaccaacccaagttt
gcctcgacccgcctgaacccagggcagacttacacccagaacaccgtcttcaaattctcc
gccgattaa

DBGET integrated database retrieval system