KEGG   Pseudomonas fluorescens PCL1751: PF1751_v1c24260Help
Entry
PF1751_v1c24260   CDS       T03766                                 

Gene name
treS
Definition
(GenBank) trehalose synthase/maltokinase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfw  Pseudomonas fluorescens PCL1751
Pathway
pfw00500  Starch and sucrose metabolism
pfw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PF1751_v1c24260 (treS)
Enzymes [BR:pfw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PF1751_v1c24260 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PF1751_v1c24260 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap MMPL
Motif
Other DBs
NCBI-ProteinID: AJP52126
LinkDB All DBs
Position
2724914..2728261
Genome map
AA seq 1115 aa AA seqDB search
MAKKPNAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGDKKGDDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPQYGYPSVNVETQAQDPHSLLNWTRRMLAVRKQSKAFGRGSLKM
LSPSNRRILAYTREFTGEDGRNEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAPENQMPSWHVEPAQSMPDFTTLVLKKRMEELLDEPCRA
SLEQTVLPAWLPKRRWFAGKDTAIDSVRIAYGVRFGDPQHPVLLSELEVTAGGQVSRYQL
PFGFLGEDQFTSALPQQLALARVRRVRQVGLVTDAFSLEHFVRAVIQGLQAGTLLNTHEG
ELRFAATPHLAKLQLTDESEVRYLSAEQSNSSVVVGECLVLKLIRKVASGVHPELEMSAY
LTEAGYPNISPLLGSMIRHDAEGQDNLLMIAQGYLSNQGDAWGWTQNNLERAIRDELAEA
MSEQEQHYNALGELADFAGLLGQRLGEMHRVLGAKTTNKDFKPEVTTVKDTQAWAKDVGA
QLDRALQLLKLHQSQLNLADQALVSELLAQKKAIASHVQALAKATAGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMALNVQGVDHSPE
ADQARKRVTDRYLKEARQAFIQAYQSATSTLAHDWQDAKGQDAALTLFSLEKAAYEVAYE
AENRPTWLPVPLQGLHGLLSGLAPISKTARGGETS
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaacgctgccacctttatcaaagacccgctctggtacaaagacgcg
gtgatttatcaggttcacgtcaaatcctatttcgactccaataacgacggtatcggtgat
tttcccggcctgatcgccaagctcgactacatcgccgatctgggcgtgaacaccatttgg
ttgctgccgttctatccctcgccacgccgtgacgatggctatgacattgccgaataccgt
ggcgtgcacagcgactacggcaccatggccgacgccaagcgcttcatcgccgaggcgcac
aagcgcgggctgcgggtgatcaccgagctggtgatcaaccacacctccgaccagcacccc
tggttccagcgcgcacgcaaggccaagcccggctcggcggcacgggacttctacgtgtgg
tcggatgacgaccagaaatacgacggcacgcgcatcatcttcctcgacaccgagaagtcc
aactggacttgggacccagtcgcgggccaatacttctggcaccgtttctactctcaccag
cccgacctcaactttgacaacccccaggtgatgaaagccgtgttgtcggtgatgcgctac
tggttggacatgggcatcgacggcctgcgcctcgacgccatcccgtacctgatcgagcgc
gacggcactaacaacgaaaaccttcctgaaacccacgatgtgctcaagcagatccgcgcc
gaaatcgacgcccattatcctgaccgtatgctgctggccgaagccaatcagtggccggaa
gacacgcagctgtacttcggtgacaagaagggcgacgacggcgatgaatgccacatggcg
tttcacttcccgctgatgccacgcatgtatatggcgctggcccaggaagatcgcttcccg
atcaccgacatcctgcgccagactccggaaattccggccaactgccagtgggcgatcttc
ctgcgcaaccacgatgagttgacattggaaatggtcaccgacaaggagcgcgattacctg
tggaactactacgccgctgaccgtcgcgcgcggatcaacctgggtattcgtcgccgtctt
gcaccgttgatggagcgtgaccgtcgtcgagtcgagctgctcaacagcctgttgctgtcg
atgcccggtacgcccaccctgtactacggcgatgagatcggcatgggcgataacatctac
ctcggcgaccgcgatggcgtgcgcacgccgatgcaatggtccatcgaccgcaatggcggg
ttctctcgcgccgacccggccagcctggtactgccgccgatcatggacccgcaatacggc
tacccgtcggtgaatgtcgagacccaggcccaggacccccattcgctgctgaactggacc
cggcgcatgctggcggtgcgcaagcagtccaaggcgtttggtcgtggcagcttgaaaatg
ctctcgccgagcaaccgccgcatcctggcctatacccgtgaattcaccggcgaagatggg
cgcaacgagatcattctctgcgtggccaacgtgtcgcgcagtgcccaggcggccgagctg
gacctgtcggcattcgccggcatggtgccggtggagatgctgggcggtaatgccttcccg
cccatcggccagttgaatttcctgctgaccctggcgccctatggcttttattggttcgtg
ctggcgccggaaaaccagatgcccagctggcacgtggagccggcccagagcatgccggac
ttcaccacgctggtgttgaaaaagcgtatggaagaactgctggacgaaccgtgtcgcgcc
tccctggaacagacagtgctgccagcctggctgcccaagcgccgctggttcgccggcaag
gacacggccatcgacagcgtgcgcattgcttacggcgtgcgctttggcgacccgcaacac
ccggtgttgctcagcgaactggaagtgacggccggtggacaggtcagtcgttatcagttg
ccgttcggtttcctcggcgaagatcagttcaccagcgccttgccgcagcaattggcgttg
gcccgtgtgcggcgcgtgcgtcaggtggggttggtgaccgatgccttcagcctcgaacac
tttgtccgcgccgtgatccaggggttgcaggcgggtaccctgctcaacacccatgaaggc
gagctgcgctttgcggccaccccgcacctggccaagctgcaactgacggatgagtccgag
gtgcgctacctgtcggccgagcagtccaacagctcggtggtggtgggcgagtgcctggtg
ctcaagctgatccgcaaagtcgcctccggcgtgcacccggaactggaaatgagcgcctac
ctgaccgaagccggctacccgaatatctcgccgttgctgggctcgatgattcgccacgac
gccgagggccaggacaacctgctgatgattgcccaaggctacttgagcaaccagggcgac
gcctggggctggacccagaataacctggagcgcgcgatccgcgacgaactggccgaagcc
atgtccgaacaggaacagcactacaacgccctcggcgagttggctgactttgccgggttg
cttggccaacgcctgggcgagatgcaccgggtgctcggcgcgaaaaccaccaacaaggac
ttcaagccggaagtcaccactgtcaaggacacccaggcctgggccaaggatgtcggcgcg
caattggaccgcgcgttgcaactgctcaaacttcatcaaagccagttgaacctggcggat
caagcgctggtcagtgaattgctggcgcagaaaaaagccatcgccagccatgtgcaggcc
ctggcgaaagccacggccggcggattgcgtattcgggtccatggtgacttgcacctgggc
caggtgctggtggtcaagggcgatgcctacctgatcgactttgaaggtgagccggcgcgc
ccactgcatgagcgacgcggcaagcacagcccgtataaagatgtgagcggcgtgttgcgt
tccttcgactatgcagcggccatggccttgaatgtacaaggggtggatcactcgcccgag
gcggaccaggcgcgcaaacgcgtgactgaccgttacctgaaagaagcacgccaggccttt
atccaggcctatcagtccgctacgtctacactggcgcatgactggcaggatgccaaaggc
caggacgcagcgctgacgttgttcagcctggagaaggccgcgtatgaagtggcctacgaa
gcggaaaaccgcccgacctggttgccagtgcccctgcaagggttgcacggactgttgagc
gggcttgcgcctatatcgaaaactgcacgcggtggggagacgtcatga

DBGET integrated database retrieval system