KEGG   Pseudomonas simiae PCL1751: PF1751_v1c27380Help
Entry
PF1751_v1c27380   CDS       T03766                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfw  Pseudomonas simiae PCL1751
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PF1751_v1c27380 (ahpF)
Enzymes [BR:pfw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PF1751_v1c27380 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_8 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AJP52438
LinkDB All DBs
Position
complement(3100428..3101993)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVVSLTTLITLKTDGDDAR
KPSFSINRPGAEISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKDAFDVLVVGGGPAGSSAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLVPAKNAGD
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTIDLEGIFVQIGLLPNTDWLKGTVELTPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggcgcgaaatcccaggaaatgcttgcccttttg
caggatgttgtcagcctcacgacgctgattaccctgaaaaccgatggtgatgatgcgcgt
aagccgtcgttctccatcaaccgcccgggtgccgagatcagcctgcgttttgccggcatc
cccatgggccatgaattcacttcgttggtcctggccctgctgcaagtcggtggccacccg
tcgaaggccagtgtcgaagtgattgaacagatccgcgcccttaaaggcgagttcagcttc
gagacctacttttcgctgtcctgccagaactgcccggacgtggtccaggcgctcaacctg
atggccgtgctcaacccgaacattcgccacgtcgccatcgacggcgcgctgttccaggct
gaagtcgatgaacgtcagatcatggcggtgcccagcgtttacttgaacggtgtgaacttc
ggccagggccgcatgggcctggaagaaattctcgccaagctcgacaccagcgggatcgaa
aaagccgccgagaaaatcagtgccaaagacgcctttgatgtgcttgtcgtcggtggtggt
ccagccggttcttcggcggccatctatgccgcacgtaaaggcattcgtaccggcgtcgct
gccgagcgttttggtggccaggtgctggacaccatgtccatcgagaacttcatctcggtg
caggaaaccgaaggcccaaaactggccagcgccctggaagcccatgtacgccagtacgac
gtggacatcatgaacctgcagcgcgccagcagcctggtgccggcgaaaaacgccggtgac
ctgcacgaaattcgtttcgaaagcggtgcgaccctcaagtccaagactgtgatcctggcc
accggcgcccgctggcgcgaaatgggtgtgccgggcgagcaggaatacaaggccaaaggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgtgtggcggtgatc
ggcggtggtaactccggcgttgaagcggccatcgacctggccggcatcgtcagccacgtc
accttgcttgagttcgacagcaagttgcgcgccgacgccgtgttgcaacgcaagctctac
agcctgcccaacgttgacgtgatcaccagcgcgctgaccagcgaagtgaaaggtgatggc
cagaaagtcaccggcctggcgtacaaggatcgcgacagcggcgagttcaagaccattgac
ctggaaggtatcttcgtacagatcggtttgctgcccaacaccgactggctcaaaggcacc
gtggagctgacgccgcgtggcgaaatcatcgtcgatgcgcgtggtgagacttcactgcca
ggtgtgttcgccgccggcgacgtgacgacggtgccgtacaagcagatcgtgattgcggtg
ggcgagggtgccaaggcttccctgagtgctttcgatcacctgatccgcacttccgctccg
gcgtaa

DBGET integrated database retrieval system