KEGG   Pseudomonas simiae PCL1751: PF1751_v1c41680Help
Entry
PF1751_v1c41680   CDS       T03766                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw00071  Fatty acid degradation
pfw00280  Valine, leucine and isoleucine degradation
pfw00281  Geraniol degradation
pfw00310  Lysine degradation
pfw00362  Benzoate degradation
pfw00380  Tryptophan metabolism
pfw00410  beta-Alanine metabolism
pfw00640  Propanoate metabolism
pfw00650  Butanoate metabolism
pfw00903  Limonene and pinene degradation
pfw00930  Caprolactam degradation
pfw01100  Metabolic pathways
pfw01110  Biosynthesis of secondary metabolites
pfw01120  Microbial metabolism in diverse environments
pfw01130  Biosynthesis of antibiotics
pfw01200  Carbon metabolism
pfw01212  Fatty acid metabolism
Module
pfw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PF1751_v1c41680
   00650 Butanoate metabolism
    PF1751_v1c41680
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PF1751_v1c41680
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PF1751_v1c41680
   00310 Lysine degradation
    PF1751_v1c41680
   00380 Tryptophan metabolism
    PF1751_v1c41680
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PF1751_v1c41680
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PF1751_v1c41680
   00281 Geraniol degradation
    PF1751_v1c41680
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PF1751_v1c41680
   00930 Caprolactam degradation
    PF1751_v1c41680
Enzymes [BR:pfw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PF1751_v1c41680
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PF1751_v1c41680
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PF1751_v1c41680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C UDPG_MGDP_dh_N F420_oxidored DUF1731
Motif
Other DBs
NCBI-ProteinID: AJP53863
LinkDB All DBs
Position
complement(4638879..4641026)
Genome map
AA seq 715 aa AA seqDB search
MTQAIRYEKGQDGIVVLTLDMPGQSANTMNGAYREAMAAMVERLEAQKDDLAGVVITSAK
KTFFAGGDLNELIKVDKAHAKDFYDSVRELKAQLRRLETLGKPVVAAINGAALGGGWEIC
LACHYRVALDDKSVQLGLPEVTLGLLPGGGGVVRMVRMLGLEKALPYLLEGKKVRPQQAL
QAGLVNELAADRDELLAKSRAWILANPDAKQPWDNKGYQIPGGTPSSPKVAQMLAIAPSI
LRSKTQGCFPAPEKILCAAVEGAQVDFDTAHLIETRYFTELVTGQVAKNMIGTFWFQLNE
INAGSSRPQGFAPYVTRKVGVLGAGMMGAGIAYVSASAGIEVVLKDINLAAAEKGKAHSA
ALLDKKVSRGQLTAEQRETFLARIHPTATDEDLAGCDLIIEAVFEDRELKAKVSAAAQSV
VGADAVIASNTSTLPISGLATAVPDQTRFIGLHFFSPVDKMPLVEIIKGARTSDETLARG
FDFVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVAAPMIETEARKAGMPVGPL
AVSDEVSLSLMNHIRQQTAKDLQAEGKAVPTHPATAVIDLLVNEYQRMGKAAGGGFYDYP
SGGHKYLWPELKSRFERPDQRISPQDVRDRLLFIQAIETVRCVEEGVLMSTADANVGSIF
GIGFAAWSGGALQFINQYGLNDFIARARYLAEQYGERFMPPALLLEKAAQGDVFR
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctattcgttacgaaaaaggccaggacggcatcgtggtgctgaccctcgac
atgcccggccaaagcgccaacaccatgaacggcgcgtaccgcgaggccatggcggcgatg
gtcgagcgtctggaagcgcaaaaagatgaccttgccggcgtggtaatcacctcggccaag
aagacattttttgccggtggcgacctgaatgaactgatcaaggtcgacaaggcccacgcc
aaggatttctacgacagcgtacgggaactgaaagcgcaactgcgccgcctggaaaccctc
ggtaaacccgtggtggccgccatcaatggcgcggcgctggggggcggctgggagatttgc
ctggcgtgtcattaccgcgtggcgctggacgacaaatcggtgcagcttggcctgccggaa
gtcaccctgggcttgctgccgggcggcggcggggtggtgcgcatggtgcgcatgcttggg
ttggaaaaggctttgccgtatttgctcgaaggcaagaaagtgcggccgcagcaggcgctg
caagccggcctggtaaatgagctggcggcggatcgcgacgagctgctggccaagtcccgc
gcctggatcctggccaatccggacgccaagcaaccgtgggacaataagggctaccagatc
ccaggcggtacaccgtcgagccccaaagtggcgcagatgctggcgattgcgccgtcgatt
ctgcgcagtaagacccagggctgtttccccgcgcccgagaagatcctctgtgccgccgtc
gaaggtgcccaagtggattttgatactgcgcacctgattgaaacccgctatttcaccgaa
ctggtgacggggcaggtggcgaagaacatgatcggcacgttctggttccagctcaatgag
atcaacgcgggtagctcccggccgcaaggttttgcgccgtacgtcacgcgcaaagtcggc
gtgctcggcgcagggatgatgggcgcaggcatcgcctacgtcagcgccagcgcaggcatc
gaggtggtgctcaaggacatcaacctggcggccgccgagaagggcaaggcgcattcggcg
gcactgctggacaagaaagtcagccgtgggcaactgaccgccgaacagagggaaaccttc
ttggcgcggattcatcctacggccaccgatgaagacctggccggttgcgacctgattatc
gaagcggtgttcgaagaccgcgaactcaaggccaaggtctcagccgccgcgcaaagtgtg
gtcggtgccgacgccgtgatcgcctccaacacctccaccttgcccatcagcggcctggcc
acggcagtgccggatcaaacccggttcatcggtctgcacttcttcagcccggtggacaag
atgcccctggtggaaatcatcaagggtgcgcgcaccagcgacgaaaccctggcccgtggt
ttcgatttcgtactgcaaatcaagaaaaccccgatcgtggtcaacgacagccgtggcttc
ttcacctcgcgggtgttcggcaccttcaccaacgaaggtatcgccatgctcggcgaaggc
gtagcggcgccgatgatcgagactgaagcgcgcaaagccggcatgccggtagggccgtta
gcggtgtcggatgaagtttccctcagcctgatgaaccatatccggcagcagacggccaag
gatctgcaggcggaaggcaaggccgtgccgacacatccggcgacagcggtgatcgatctg
ctggtcaacgaataccagcgcatgggcaaggcggcgggcggcggcttctatgactatccc
agcggcgggcacaagtacctgtggccggagctgaaaagccgctttgaacggcccgaccaa
cgtatctcgccacaggatgtgcgcgaccgcctgctgtttatccaagcgatcgagactgta
cggtgtgtggaggagggggtgttgatgtccacggcggacgccaacgtggggtcgatcttc
ggcattggcttcgcggcctggagcggtggcgcgttgcagtttatcaaccaatatgggctg
aacgacttcatagcccgcgcccgctacctggccgagcaatatggcgaacgcttcatgccg
cccgcgttgttgctggagaaagccgcgcaaggtgacgtgttccggtga

DBGET integrated database retrieval system