KEGG   Pseudomonas simiae PCL1751: PF1751_v1c42520
Entry
PF1751_v1c42520   CDS       T03766                                 

Gene name
alaS
Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PF1751_v1c42520 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfw01007]
    PF1751_v1c42520 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfw03016]
    PF1751_v1c42520 (alaS)
Enzymes [BR:pfw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     PF1751_v1c42520 (alaS)
Amino acid related enzymes [BR:pfw01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   PF1751_v1c42520 (alaS)
Transfer RNA biogenesis [BR:pfw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PF1751_v1c42520 (alaS)
 Prokaryotic type
    PF1751_v1c42520 (alaS)
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD DUF1319 CorA Gasdermin_C Jnk-SapK_ap_N
Other DBs
NCBI-ProteinID: AJP53947
LinkDB
Position
complement(4722328..4724946)
AA seq 872 aa
MKSAEIREAFLRFFEEQGHTRVASSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA
VSSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAINFAWTFLTGVLKLP
KEKLWVTVYASDDEAYDIWTKEVGVPAERMVRIGDNKGAPYASDNFWTMGDTGPCGPCTE
IFYDHGADIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVLHPLPAPSVDTGMGLERI
SAVMQHVHSNYEIDLFQSLLAAAAKAIGCTNEDQASLKVVADHIRSCGFLIADGVLPSNE
GRGYVLRRIIRRACRHGNKLGANGSFFYQIVAALVAEMGEAFPELKQNQAHIERVLKAEE
EQFAKTLEQGLKILEQDLANLQGSVVPGDVVFKLYDTYGFPMDLTGDIARERNLTLDEEG
FEREMEAQRVRARSASSFGMDYNSLVKVDVATEFTGYKATRGAAKVVALYKEGQSVDVLN
EGDDGVVVLDQTPFYAESGGQIGDCGFLEASSGRFDVRDTTKTGGAFLHHGVLASGSLTV
GSPVEAQVDADVRHATSLNHSATHLLHAALRQVLGEHVQQKGSLVDSQRLRFDFSHFEAI
KPEQIKALEDIVNAEIRKNTAVETEETDIETAKAKGAMALFGEKYGDSVRVLSMGGDFSV
ELCGGIHANRTGDIALLKIVSEGGVASGVRRIEAVTGAAALAYLNAAEEQLKEAASLVKG
SRDNLIDKLSAVLERNRALEKQLEQLQAKAASAAGDDLSASAVDVKDVKVLAARLDGQDG
KALLALVDQLKNKLGRAVILLGGVHEDKVVLVAGVTKDLTGQLKAGDLMKQAAAAVGGKG
GGRPDMAQGGGVDAGALDAALALTVPFVEAGI
NT seq 2619 nt   +upstreamnt  +downstreamnt
atgaaaagcgcagaaatccgtgaagccttccttcgcttcttcgaagagcaaggtcacacc
cgtgtcgcctccagctccttgatcccaggcaatgacccaaccctgctgttcaccaacgcg
gggatgaaccagttcaaggactgcttcctgggccaggaaaagcgcgcgtacacccgcgcc
gtcagcagccagaaatgcgtccgcgccggtggcaagcacaacgacctggaaaacgtcggc
tacaccgcccgtcaccacacttttttcgaaatgctcggcaacttcagctttggcgattat
ttcaagcaagacgcgatcaacttcgcctggaccttcctcaccggcgtgctgaagctgccc
aaggaaaaactctgggttaccgtctacgccagcgatgacgaggcctacgacatttggacc
aaagaagtcggcgtgccggctgagcgcatggtgcgcatcggtgacaacaaaggcgctcca
tacgcctccgacaacttctggaccatgggcgataccggcccgtgcggcccttgcaccgag
atcttctacgaccacggcgccgacatctggggcggcccaccgggctcgccagaggaagac
ggcgaccgttacatcgagatctggaacaacgtgttcatgcagttcaaccgcaccgccgac
ggcgtgttgcatccgttgccagcgccgtcggtggataccggcatgggcctggagcggatc
agtgcggtgatgcagcacgtgcattccaactacgagatcgacctgttccaaagcctgctg
gccgcggcggccaaggccattggttgcaccaatgaagaccaggcctcgctgaaagtcgtg
gctgaccatatccggtcctgcggcttcctgattgccgacggcgtgctgccgtccaacgaa
ggccgtggctatgtgctgcgtcgcatcatccgtcgtgcttgccgtcacggtaacaagctg
ggtgccaacggcagcttcttctatcagatcgtcgcggccctggtggccgagatgggcgaa
gccttcccggaactcaagcagaaccaggcgcatatcgagcgcgtgctcaaagctgaagaa
gagcagttcgccaagaccctggaacagggcctgaagatccttgaacaggaccttgccaac
ctgcaaggctccgtcgtgccgggcgacgtggtgttcaagctctacgacacctacggtttc
ccgatggacttgaccggcgacatcgcccgtgaacgcaacctgaccctcgacgaggaaggt
ttcgaacgcgagatggaagcccagcgtgtgcgcgcacgttcggccagctcgttcggcatg
gactacaacagcctggtcaaggttgacgtggccaccgaattcaccggctacaaggccacc
cgtggtgcggccaaagtggttgctctctataaggaaggccagtcggtcgacgtattgaac
gaaggggatgacggcgtggtggttctggaccagacgccgttctacgccgagtccggtggc
cagatcggcgactgcggtttccttgaagcctcgtccggacgttttgacgtacgcgacacc
accaagacgggcggcgcgttcctgcaccacggtgtgttggcgtcgggcagcctgaccgtc
ggttcgccggtcgaggcgcaagtggacgccgatgtgcgccacgccacctcgctgaaccat
tcggccacgcacttgctgcacgccgcgctgcgccaggtactgggcgagcacgtccagcag
aaagggtcgttggtcgacagccagcgcctgcgcttcgacttcagccactttgaagcgatc
aagccggagcagatcaaggccctggaagacatcgtcaacgccgagattcgcaagaacacc
gcagtcgaaaccgaagaaaccgatatcgagaccgccaaggccaagggcgccatggcgctg
ttcggcgagaagtacggcgacagcgtgcgcgtattgagcatgggcggcgatttctcggta
gaactgtgtggcggtatccacgccaaccgtaccggcgacatcgccctgctgaagatcgtc
agcgaaggtggcgtggcgtccggtgtgcgtcgtatcgaggcagtcaccggcgctgcggcc
ctggcctacctcaatgcggctgaagaacaactcaaggaagcggccagcctggtcaagggc
agccgcgacaacctgatcgacaaactgtccgctgtgctggagcgcaaccgcgcgctggag
aaacagctggagcagttgcaagccaaggcggccagcgcggcaggcgacgatctgtcggct
tctgcggtggacgtcaaggatgtgaaagtcctggctgcacgcctggacggtcaggacggc
aaggcgctgttggctttggtcgatcagttgaagaacaagctcggccgcgcagtgatcctg
ctcggcggtgtccatgaggataaggtcgttctggttgccggcgtaaccaaggacctgact
ggccaactcaaggccggtgatttgatgaagcaagccgccgcggcagtgggcgggaagggc
ggtggtcgtccggacatggcgcaaggcggtggtgtcgacgccggtgccctggacgcagcc
ctggccctgaccgtgccatttgtcgaggcaggtatttaa

DBGET integrated database retrieval system